BLASTX nr result
ID: Papaver31_contig00040458
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00040458 (1110 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008452907.1| PREDICTED: U11/U12 small nuclear ribonucleop... 62 7e-07 ref|XP_008452908.1| PREDICTED: U11/U12 small nuclear ribonucleop... 62 7e-07 gb|ERM96288.1| hypothetical protein AMTR_s00001p00174360 [Ambore... 62 9e-07 ref|XP_011628930.1| PREDICTED: uncharacterized protein LOC184242... 62 1e-06 ref|XP_010933347.1| PREDICTED: U11/U12 small nuclear ribonucleop... 62 1e-06 gb|KHG23491.1| U11/U12 small nuclear ribonucleoprotein 25 kDa [G... 61 2e-06 gb|KJB27368.1| hypothetical protein B456_004G2943001, partial [G... 59 6e-06 ref|XP_010312618.1| PREDICTED: U11/U12 small nuclear ribonucleop... 59 6e-06 ref|XP_010312617.1| PREDICTED: U11/U12 small nuclear ribonucleop... 59 6e-06 ref|XP_010312616.1| PREDICTED: uncharacterized protein LOC101252... 59 6e-06 ref|XP_010312615.1| PREDICTED: U11/U12 small nuclear ribonucleop... 59 6e-06 ref|XP_007017930.1| Ubiquitin-like superfamily protein isoform 2... 59 6e-06 ref|XP_007017929.1| Ubiquitin-like superfamily protein isoform 1... 59 6e-06 ref|XP_004250082.1| PREDICTED: U11/U12 small nuclear ribonucleop... 59 6e-06 ref|XP_007223561.1| hypothetical protein PRUPE_ppa012232mg [Prun... 59 7e-06 ref|XP_004145525.1| PREDICTED: U11/U12 small nuclear ribonucleop... 59 7e-06 gb|KHG19629.1| U11/U12 small nuclear ribonucleoprotein 25 kDa [G... 59 9e-06 >ref|XP_008452907.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 25 kDa protein isoform X1 [Cucumis melo] Length = 198 Score = 62.4 bits (150), Expect = 7e-07 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = -2 Query: 587 VYWRHVWGNFCLLHHNEKLIDDKSVLQDFSMRN 489 + W+HVW NFCL HHNEK++DD SVLQDF +RN Sbjct: 132 ISWKHVWANFCLAHHNEKILDDSSVLQDFGIRN 164 >ref|XP_008452908.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 25 kDa protein isoform X2 [Cucumis melo] gi|659104347|ref|XP_008452909.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 25 kDa protein isoform X2 [Cucumis melo] gi|307136304|gb|ADN34128.1| hypothetical protein [Cucumis melo subsp. melo] Length = 181 Score = 62.4 bits (150), Expect = 7e-07 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = -2 Query: 587 VYWRHVWGNFCLLHHNEKLIDDKSVLQDFSMRN 489 + W+HVW NFCL HHNEK++DD SVLQDF +RN Sbjct: 115 ISWKHVWANFCLAHHNEKILDDSSVLQDFGIRN 147 >gb|ERM96288.1| hypothetical protein AMTR_s00001p00174360 [Amborella trichopoda] Length = 219 Score = 62.0 bits (149), Expect = 9e-07 Identities = 24/37 (64%), Positives = 28/37 (75%) Frame = -2 Query: 587 VYWRHVWGNFCLLHHNEKLIDDKSVLQDFSMRNKY*Y 477 + WRHVW NFCL HHNEKL+DD S+L DF +RN Y Sbjct: 104 ISWRHVWSNFCLSHHNEKLLDDNSILHDFGVRNNSQY 140 >ref|XP_011628930.1| PREDICTED: uncharacterized protein LOC18424218 [Amborella trichopoda] Length = 314 Score = 61.6 bits (148), Expect = 1e-06 Identities = 23/33 (69%), Positives = 27/33 (81%) Frame = -2 Query: 587 VYWRHVWGNFCLLHHNEKLIDDKSVLQDFSMRN 489 + WRHVW NFCL HHNEKL+DD S+L DF +RN Sbjct: 248 ISWRHVWSNFCLSHHNEKLLDDNSILHDFGVRN 280 >ref|XP_010933347.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 25 kDa protein isoform X3 [Elaeis guineensis] Length = 241 Score = 61.6 bits (148), Expect = 1e-06 Identities = 21/33 (63%), Positives = 29/33 (87%) Frame = -2 Query: 587 VYWRHVWGNFCLLHHNEKLIDDKSVLQDFSMRN 489 + WRH+W NFCL+HHNEKL+DD S+L+D+ +RN Sbjct: 179 ISWRHIWANFCLVHHNEKLVDDNSLLRDYGLRN 211 >gb|KHG23491.1| U11/U12 small nuclear ribonucleoprotein 25 kDa [Gossypium arboreum] Length = 173 Score = 60.8 bits (146), Expect = 2e-06 Identities = 23/33 (69%), Positives = 27/33 (81%) Frame = -2 Query: 587 VYWRHVWGNFCLLHHNEKLIDDKSVLQDFSMRN 489 + WRHVW NFCL HHNEKL+DD + LQDF +RN Sbjct: 107 ISWRHVWANFCLAHHNEKLLDDGAALQDFGVRN 139 >gb|KJB27368.1| hypothetical protein B456_004G2943001, partial [Gossypium raimondii] Length = 83 Score = 59.3 bits (142), Expect = 6e-06 Identities = 22/35 (62%), Positives = 26/35 (74%) Frame = -2 Query: 587 VYWRHVWGNFCLLHHNEKLIDDKSVLQDFSMRNKY 483 + WRHVW NFCL HHN KL+DD + L DF +RN Y Sbjct: 13 ISWRHVWANFCLAHHNGKLLDDDAALHDFGVRNNY 47 >ref|XP_010312618.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 25 kDa protein isoform X5 [Solanum lycopersicum] Length = 240 Score = 59.3 bits (142), Expect = 6e-06 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = -2 Query: 587 VYWRHVWGNFCLLHHNEKLIDDKSVLQDFSMRN 489 + WRHVW NFCLL HNEKL+DD + LQD+S+RN Sbjct: 170 ISWRHVWSNFCLLFHNEKLLDDTAKLQDYSIRN 202 >ref|XP_010312617.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 25 kDa protein isoform X4 [Solanum lycopersicum] Length = 264 Score = 59.3 bits (142), Expect = 6e-06 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = -2 Query: 587 VYWRHVWGNFCLLHHNEKLIDDKSVLQDFSMRN 489 + WRHVW NFCLL HNEKL+DD + LQD+S+RN Sbjct: 194 ISWRHVWSNFCLLFHNEKLLDDTAKLQDYSIRN 226 >ref|XP_010312616.1| PREDICTED: uncharacterized protein LOC101252038 isoform X3 [Solanum lycopersicum] Length = 311 Score = 59.3 bits (142), Expect = 6e-06 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = -2 Query: 587 VYWRHVWGNFCLLHHNEKLIDDKSVLQDFSMRN 489 + WRHVW NFCLL HNEKL+DD + LQD+S+RN Sbjct: 241 ISWRHVWSNFCLLFHNEKLLDDTAKLQDYSIRN 273 >ref|XP_010312615.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 25 kDa protein isoform X2 [Solanum lycopersicum] Length = 313 Score = 59.3 bits (142), Expect = 6e-06 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = -2 Query: 587 VYWRHVWGNFCLLHHNEKLIDDKSVLQDFSMRN 489 + WRHVW NFCLL HNEKL+DD + LQD+S+RN Sbjct: 243 ISWRHVWSNFCLLFHNEKLLDDTAKLQDYSIRN 275 >ref|XP_007017930.1| Ubiquitin-like superfamily protein isoform 2 [Theobroma cacao] gi|508723258|gb|EOY15155.1| Ubiquitin-like superfamily protein isoform 2 [Theobroma cacao] Length = 333 Score = 59.3 bits (142), Expect = 6e-06 Identities = 22/33 (66%), Positives = 27/33 (81%) Frame = -2 Query: 587 VYWRHVWGNFCLLHHNEKLIDDKSVLQDFSMRN 489 + WRHVW NFCL HHNEKL+D+ + LQDF +RN Sbjct: 267 ISWRHVWANFCLAHHNEKLLDEGAALQDFGVRN 299 >ref|XP_007017929.1| Ubiquitin-like superfamily protein isoform 1 [Theobroma cacao] gi|508723257|gb|EOY15154.1| Ubiquitin-like superfamily protein isoform 1 [Theobroma cacao] Length = 395 Score = 59.3 bits (142), Expect = 6e-06 Identities = 22/33 (66%), Positives = 27/33 (81%) Frame = -2 Query: 587 VYWRHVWGNFCLLHHNEKLIDDKSVLQDFSMRN 489 + WRHVW NFCL HHNEKL+D+ + LQDF +RN Sbjct: 329 ISWRHVWANFCLAHHNEKLLDEGAALQDFGVRN 361 >ref|XP_004250082.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 25 kDa protein isoform X1 [Solanum lycopersicum] gi|723741385|ref|XP_010312612.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 25 kDa protein isoform X1 [Solanum lycopersicum] gi|723741388|ref|XP_010312613.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 25 kDa protein isoform X1 [Solanum lycopersicum] gi|723741391|ref|XP_010312614.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 25 kDa protein isoform X1 [Solanum lycopersicum] Length = 314 Score = 59.3 bits (142), Expect = 6e-06 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = -2 Query: 587 VYWRHVWGNFCLLHHNEKLIDDKSVLQDFSMRN 489 + WRHVW NFCLL HNEKL+DD + LQD+S+RN Sbjct: 244 ISWRHVWSNFCLLFHNEKLLDDTAKLQDYSIRN 276 >ref|XP_007223561.1| hypothetical protein PRUPE_ppa012232mg [Prunus persica] gi|462420497|gb|EMJ24760.1| hypothetical protein PRUPE_ppa012232mg [Prunus persica] Length = 178 Score = 58.9 bits (141), Expect = 7e-06 Identities = 21/33 (63%), Positives = 28/33 (84%) Frame = -2 Query: 587 VYWRHVWGNFCLLHHNEKLIDDKSVLQDFSMRN 489 + W+HVWGNFCL +HN+KL+DD + LQDF +RN Sbjct: 134 ISWKHVWGNFCLSYHNDKLLDDNAALQDFGVRN 166 >ref|XP_004145525.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 25 kDa protein [Cucumis sativus] gi|778697041|ref|XP_011654244.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 25 kDa protein [Cucumis sativus] gi|700200314|gb|KGN55472.1| hypothetical protein Csa_4G652840 [Cucumis sativus] Length = 181 Score = 58.9 bits (141), Expect = 7e-06 Identities = 23/33 (69%), Positives = 27/33 (81%) Frame = -2 Query: 587 VYWRHVWGNFCLLHHNEKLIDDKSVLQDFSMRN 489 + W+HVW NFCL H NEKL+DD SVLQDF +RN Sbjct: 115 ISWKHVWANFCLAHLNEKLLDDSSVLQDFGIRN 147 >gb|KHG19629.1| U11/U12 small nuclear ribonucleoprotein 25 kDa [Gossypium arboreum] Length = 173 Score = 58.5 bits (140), Expect = 9e-06 Identities = 22/33 (66%), Positives = 27/33 (81%) Frame = -2 Query: 587 VYWRHVWGNFCLLHHNEKLIDDKSVLQDFSMRN 489 + WRHVW NFCL +HNEKL+DD + LQDF +RN Sbjct: 107 ISWRHVWANFCLAYHNEKLLDDGAALQDFGVRN 139