BLASTX nr result
ID: Papaver31_contig00040281
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00040281 (468 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABN05744.1| hypothetical protein MtrDRAFT_AC148775g4v2 [Medic... 88 6e-29 gb|ABD32857.1| hypothetical protein MtrDRAFT_AC149038g20v2 [Medi... 86 8e-15 gb|ABD32510.1| hypothetical protein MtrDRAFT_AC147482g27v2 [Medi... 81 5e-14 ref|XP_003623809.1| subtilisin-like serine protease [Medicago tr... 65 3e-08 ref|XP_003615063.1| transmembrane protein, putative [Medicago tr... 43 1e-07 ref|XP_013451408.1| transmembrane protein, putative [Medicago tr... 60 6e-07 ref|XP_013460605.1| transmembrane protein, putative [Medicago tr... 54 8e-07 >gb|ABN05744.1| hypothetical protein MtrDRAFT_AC148775g4v2 [Medicago truncatula] Length = 203 Score = 87.8 bits (216), Expect(2) = 6e-29 Identities = 37/52 (71%), Positives = 45/52 (86%) Frame = -2 Query: 158 CLDTYGEHAVHCKVDPGFKFRHNHVRDILYDVFWRAGISAKKEAAVNFLTNP 3 CLDT+GEH VHCK PGFK+RH+ VRD+L+D+F RAG+S KKEA VNFLT+P Sbjct: 70 CLDTFGEHVVHCKELPGFKYRHDFVRDVLFDIFRRAGVSVKKEAPVNFLTDP 121 Score = 66.6 bits (161), Expect(2) = 6e-29 Identities = 30/50 (60%), Positives = 40/50 (80%) Frame = -3 Query: 361 MDRDYELSDRQKAALGCLRATHAQDFLLAIPIEGLGQKMSPVEYRSILKY 212 M+ ++++ RQK GCL+ HAQDFLLAIPI+GLG+ MS VEYR+IL+Y Sbjct: 1 MEVKFDMTTRQKTIFGCLQEPHAQDFLLAIPIDGLGRHMSLVEYRTILRY 50 >gb|ABD32857.1| hypothetical protein MtrDRAFT_AC149038g20v2 [Medicago truncatula] Length = 202 Score = 86.3 bits (212), Expect = 8e-15 Identities = 35/52 (67%), Positives = 46/52 (88%) Frame = -2 Query: 158 CLDTYGEHAVHCKVDPGFKFRHNHVRDILYDVFWRAGISAKKEAAVNFLTNP 3 C+DT+GEHAVHCK PGF++RH+ VRD+L+D+F RAG+S KKE +VNFLT+P Sbjct: 18 CMDTFGEHAVHCKELPGFQYRHDFVRDVLFDIFRRAGVSVKKETSVNFLTDP 69 >gb|ABD32510.1| hypothetical protein MtrDRAFT_AC147482g27v2 [Medicago truncatula] Length = 217 Score = 80.9 bits (198), Expect(2) = 5e-14 Identities = 35/52 (67%), Positives = 42/52 (80%) Frame = -2 Query: 158 CLDTYGEHAVHCKVDPGFKFRHNHVRDILYDVFWRAGISAKKEAAVNFLTNP 3 CLDT+GEHAVHCK P FK+ H+ VRD+L+D+F R GIS KKEA VNFL +P Sbjct: 32 CLDTFGEHAVHCKEFPSFKYIHDFVRDVLFDIFRRVGISVKKEAPVNFLIDP 83 Score = 23.1 bits (48), Expect(2) = 5e-14 Identities = 9/11 (81%), Positives = 11/11 (100%) Frame = -3 Query: 247 MSPVEYRSILK 215 MSPVEYR+IL+ Sbjct: 1 MSPVEYRTILR 11 >ref|XP_003623809.1| subtilisin-like serine protease [Medicago truncatula] gi|355498824|gb|AES80027.1| subtilisin-like serine protease [Medicago truncatula] Length = 900 Score = 64.7 bits (156), Expect = 3e-08 Identities = 28/46 (60%), Positives = 36/46 (78%) Frame = -2 Query: 140 EHAVHCKVDPGFKFRHNHVRDILYDVFWRAGISAKKEAAVNFLTNP 3 +H VHCK FK++H+ VRD+L+D+F RAG S KKEA VNFLT+P Sbjct: 2 KHVVHCKELLSFKYKHDFVRDVLFDIFRRAGASVKKEAPVNFLTDP 47 >ref|XP_003615063.1| transmembrane protein, putative [Medicago truncatula] gi|355516398|gb|AES98021.1| transmembrane protein, putative [Medicago truncatula] Length = 203 Score = 42.7 bits (99), Expect(2) = 1e-07 Identities = 23/52 (44%), Positives = 26/52 (50%) Frame = -2 Query: 158 CLDTYGEHAVHCKVDPGFKFRHNHVRDILYDVFWRAGISAKKEAAVNFLTNP 3 CLDT+GEH V+CK GIS KKEA VNFLT+P Sbjct: 54 CLDTFGEHVVYCK---------------------EVGISVKKEAPVNFLTDP 84 Score = 40.0 bits (92), Expect(2) = 1e-07 Identities = 18/29 (62%), Positives = 24/29 (82%) Frame = -3 Query: 298 HAQDFLLAIPIEGLGQKMSPVEYRSILKY 212 + QDFLLAI I+GLG +SPV+YR+ L+Y Sbjct: 6 NVQDFLLAILIDGLGHLLSPVKYRTDLRY 34 >ref|XP_013451408.1| transmembrane protein, putative [Medicago truncatula] gi|657381462|gb|KEH25448.1| transmembrane protein, putative [Medicago truncatula] Length = 121 Score = 60.1 bits (144), Expect = 6e-07 Identities = 28/50 (56%), Positives = 37/50 (74%) Frame = -3 Query: 361 MDRDYELSDRQKAALGCLRATHAQDFLLAIPIEGLGQKMSPVEYRSILKY 212 M+ ++++ RQK CL+ THAQ FLLAI I+GL Q MSP+EYR+IL Y Sbjct: 1 MEVKFDMTTRQKVVFRCLQTTHAQYFLLAILIDGLSQHMSPIEYRTILIY 50 >ref|XP_013460605.1| transmembrane protein, putative [Medicago truncatula] gi|657393885|gb|KEH34639.1| transmembrane protein, putative [Medicago truncatula] Length = 160 Score = 53.5 bits (127), Expect(2) = 8e-07 Identities = 28/55 (50%), Positives = 38/55 (69%), Gaps = 1/55 (1%) Frame = -3 Query: 418 PP*STK*LASALF-GKVVKDMDRDYELSDRQKAALGCLRATHAQDFLLAIPIEGL 257 PP + LA+A+F K V+DM+ +++ R A LGCL+ THA DFLLAI I+GL Sbjct: 93 PPKAQHVLANAVFFSKSVQDMEVKFDMITRHNAVLGCLQTTHAHDFLLAISIDGL 147 Score = 26.2 bits (56), Expect(2) = 8e-07 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -1 Query: 465 TLPDYDFSSFTSKDTAPLKVQ 403 T+ D+ SSFT+KD P K Q Sbjct: 77 TILDFGISSFTNKDIVPPKAQ 97