BLASTX nr result
ID: Papaver31_contig00039732
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00039732 (482 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012090904.1| PREDICTED: putative F-box/FBD/LRR-repeat pro... 59 2e-06 >ref|XP_012090904.1| PREDICTED: putative F-box/FBD/LRR-repeat protein At1g78760 [Jatropha curcas] gi|802777509|ref|XP_012090905.1| PREDICTED: putative F-box/FBD/LRR-repeat protein At1g78760 [Jatropha curcas] gi|802777513|ref|XP_012090906.1| PREDICTED: putative F-box/FBD/LRR-repeat protein At1g78760 [Jatropha curcas] gi|643705149|gb|KDP21766.1| hypothetical protein JCGZ_00553 [Jatropha curcas] Length = 449 Score = 58.5 bits (140), Expect = 2e-06 Identities = 32/78 (41%), Positives = 53/78 (67%), Gaps = 1/78 (1%) Frame = -2 Query: 472 SLPQYSLPNLKVVVIRDFIGCKVELDVVKFFLANAGVLQTMTIMISEFLSE-DYKKQTQI 296 ++P+ +LK V +R F G +VE+ V+++FL NA VL+ + I E+L + D KK+T++ Sbjct: 374 AVPRCFFSSLKRVELRGFEGNRVEMKVIRYFLKNAKVLKKLAI---EYLDDMDPKKETKL 430 Query: 295 ASELLKFPRYSASCALEF 242 +LLKFPR S++C + F Sbjct: 431 LKKLLKFPRASSTCQIIF 448