BLASTX nr result
ID: Papaver31_contig00039139
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00039139 (502 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP13895.1| unnamed protein product [Coffea canephora] 70 6e-10 ref|XP_006356478.1| PREDICTED: rhodanese-like domain-containing ... 65 2e-08 gb|KNA06434.1| hypothetical protein SOVF_181160 [Spinacia oleracea] 65 3e-08 ref|XP_011001381.1| PREDICTED: rhodanese-like domain-containing ... 64 4e-08 ref|XP_010067622.1| PREDICTED: rhodanese-like domain-containing ... 64 4e-08 ref|XP_002325492.2| hypothetical protein POPTR_0019s08750g [Popu... 64 4e-08 gb|KMT17435.1| hypothetical protein BVRB_2g038870 [Beta vulgaris... 63 1e-07 ref|XP_012454515.1| PREDICTED: rhodanese-like domain-containing ... 63 1e-07 gb|KJB72969.1| hypothetical protein B456_011G206700 [Gossypium r... 63 1e-07 gb|KJB72968.1| hypothetical protein B456_011G206700 [Gossypium r... 63 1e-07 ref|XP_010670060.1| PREDICTED: rhodanese-like domain-containing ... 63 1e-07 gb|KHG17125.1| Uncharacterized protein F383_23684 [Gossypium arb... 63 1e-07 ref|XP_009778305.1| PREDICTED: rhodanese-like domain-containing ... 63 1e-07 ref|XP_009624145.1| PREDICTED: rhodanese-like domain-containing ... 63 1e-07 ref|XP_004146431.2| PREDICTED: rhodanese-like domain-containing ... 62 2e-07 ref|XP_004235230.1| PREDICTED: rhodanese-like domain-containing ... 62 2e-07 ref|XP_006842503.2| PREDICTED: rhodanese-like domain-containing ... 62 2e-07 gb|ERN04178.1| hypothetical protein AMTR_s00077p00102160 [Ambore... 62 2e-07 ref|XP_010938023.1| PREDICTED: rhodanese-like domain-containing ... 61 3e-07 ref|XP_012091126.1| PREDICTED: rhodanese-like domain-containing ... 61 4e-07 >emb|CDP13895.1| unnamed protein product [Coffea canephora] Length = 480 Score = 70.1 bits (170), Expect = 6e-10 Identities = 31/40 (77%), Positives = 36/40 (90%) Frame = +3 Query: 3 EEKDRARARQRQFEAWGVIGGPDKGRRPVKAVDDGNSTGD 122 EEK+RARARQRQFE WG+IGGPDKGRRPV+A +G STG+ Sbjct: 436 EEKERARARQRQFERWGIIGGPDKGRRPVRAGCNGESTGE 475 >ref|XP_006356478.1| PREDICTED: rhodanese-like domain-containing protein 7-like [Solanum tuberosum] Length = 479 Score = 65.1 bits (157), Expect = 2e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +3 Query: 3 EEKDRARARQRQFEAWGVIGGPDKGRRPVKAVD 101 EEK+RARARQRQFE WG+IGGPDKGRRP K VD Sbjct: 434 EEKERARARQRQFEKWGIIGGPDKGRRPAKTVD 466 >gb|KNA06434.1| hypothetical protein SOVF_181160 [Spinacia oleracea] Length = 453 Score = 64.7 bits (156), Expect = 3e-08 Identities = 29/43 (67%), Positives = 37/43 (86%) Frame = +3 Query: 3 EEKDRARARQRQFEAWGVIGGPDKGRRPVKAVDDGNSTGDNHQ 131 EEK+RARARQRQFE WGVIGGPDKGRRP +++++ + GD+ Q Sbjct: 407 EEKERARARQRQFEVWGVIGGPDKGRRPAQSINEPQN-GDSSQ 448 >ref|XP_011001381.1| PREDICTED: rhodanese-like domain-containing protein 7 [Populus euphratica] Length = 464 Score = 63.9 bits (154), Expect = 4e-08 Identities = 29/37 (78%), Positives = 30/37 (81%) Frame = +3 Query: 3 EEKDRARARQRQFEAWGVIGGPDKGRRPVKAVDDGNS 113 EEK+RARARQRQFE WGVIGGPDKGRRP D NS Sbjct: 418 EEKERARARQRQFETWGVIGGPDKGRRPTFKPDSNNS 454 >ref|XP_010067622.1| PREDICTED: rhodanese-like domain-containing protein 7 [Eucalyptus grandis] gi|629100026|gb|KCW65791.1| hypothetical protein EUGRSUZ_G03146 [Eucalyptus grandis] Length = 472 Score = 63.9 bits (154), Expect = 4e-08 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = +3 Query: 3 EEKDRARARQRQFEAWGVIGGPDKGRRPVKAVDDGNSTGD 122 EEK+RARARQRQFE WG+IGGP KGRRP+ + D+ ST D Sbjct: 427 EEKERARARQRQFEMWGIIGGPHKGRRPITSPDNNKSTID 466 >ref|XP_002325492.2| hypothetical protein POPTR_0019s08750g [Populus trichocarpa] gi|550317041|gb|EEE99873.2| hypothetical protein POPTR_0019s08750g [Populus trichocarpa] Length = 464 Score = 63.9 bits (154), Expect = 4e-08 Identities = 29/37 (78%), Positives = 30/37 (81%) Frame = +3 Query: 3 EEKDRARARQRQFEAWGVIGGPDKGRRPVKAVDDGNS 113 EEK+RARARQRQFE WGVIGGPDKGRRP D NS Sbjct: 418 EEKERARARQRQFETWGVIGGPDKGRRPTFKPDSNNS 454 >gb|KMT17435.1| hypothetical protein BVRB_2g038870 [Beta vulgaris subsp. vulgaris] Length = 455 Score = 62.8 bits (151), Expect = 1e-07 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = +3 Query: 3 EEKDRARARQRQFEAWGVIGGPDKGRRPVKAVDD 104 EEK+RARARQRQFE WGVIGGPDKGRRP + +D Sbjct: 406 EEKERARARQRQFEVWGVIGGPDKGRRPTHSTND 439 >ref|XP_012454515.1| PREDICTED: rhodanese-like domain-containing protein 7 [Gossypium raimondii] Length = 465 Score = 62.8 bits (151), Expect = 1e-07 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +3 Query: 3 EEKDRARARQRQFEAWGVIGGPDKGRRPVKAVD 101 EEK+RARARQRQFEAWG+IGGPDKGRRP D Sbjct: 418 EEKERARARQRQFEAWGIIGGPDKGRRPAAKAD 450 >gb|KJB72969.1| hypothetical protein B456_011G206700 [Gossypium raimondii] Length = 479 Score = 62.8 bits (151), Expect = 1e-07 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +3 Query: 3 EEKDRARARQRQFEAWGVIGGPDKGRRPVKAVD 101 EEK+RARARQRQFEAWG+IGGPDKGRRP D Sbjct: 432 EEKERARARQRQFEAWGIIGGPDKGRRPAAKAD 464 >gb|KJB72968.1| hypothetical protein B456_011G206700 [Gossypium raimondii] Length = 474 Score = 62.8 bits (151), Expect = 1e-07 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +3 Query: 3 EEKDRARARQRQFEAWGVIGGPDKGRRPVKAVD 101 EEK+RARARQRQFEAWG+IGGPDKGRRP D Sbjct: 427 EEKERARARQRQFEAWGIIGGPDKGRRPAAKAD 459 >ref|XP_010670060.1| PREDICTED: rhodanese-like domain-containing protein 7 [Beta vulgaris subsp. vulgaris] Length = 472 Score = 62.8 bits (151), Expect = 1e-07 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = +3 Query: 3 EEKDRARARQRQFEAWGVIGGPDKGRRPVKAVDD 104 EEK+RARARQRQFE WGVIGGPDKGRRP + +D Sbjct: 423 EEKERARARQRQFEVWGVIGGPDKGRRPTHSTND 456 >gb|KHG17125.1| Uncharacterized protein F383_23684 [Gossypium arboreum] Length = 451 Score = 62.8 bits (151), Expect = 1e-07 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +3 Query: 3 EEKDRARARQRQFEAWGVIGGPDKGRRPVKAVD 101 EEK+RARARQRQFEAWG+IGGPDKGRRP D Sbjct: 404 EEKERARARQRQFEAWGIIGGPDKGRRPAAKAD 436 >ref|XP_009778305.1| PREDICTED: rhodanese-like domain-containing protein 7 [Nicotiana sylvestris] Length = 468 Score = 62.8 bits (151), Expect = 1e-07 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +3 Query: 3 EEKDRARARQRQFEAWGVIGGPDKGRRPVKAVD 101 EEK+RARARQ+QFE WG+IGGPDKGRRP KAV+ Sbjct: 423 EEKERARARQKQFERWGIIGGPDKGRRPEKAVN 455 >ref|XP_009624145.1| PREDICTED: rhodanese-like domain-containing protein 7 [Nicotiana tomentosiformis] Length = 467 Score = 62.8 bits (151), Expect = 1e-07 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +3 Query: 3 EEKDRARARQRQFEAWGVIGGPDKGRRPVKAVD 101 EEK+RARARQ+QFE WG+IGGPDKGRRP KAV+ Sbjct: 422 EEKERARARQKQFERWGIIGGPDKGRRPEKAVN 454 >ref|XP_004146431.2| PREDICTED: rhodanese-like domain-containing protein 7 [Cucumis sativus] gi|700195573|gb|KGN50750.1| hypothetical protein Csa_5G223080 [Cucumis sativus] Length = 457 Score = 62.0 bits (149), Expect = 2e-07 Identities = 29/45 (64%), Positives = 32/45 (71%) Frame = +3 Query: 3 EEKDRARARQRQFEAWGVIGGPDKGRRPVKAVDDGNSTGDNHQHP 137 EEK+RARARQRQFE WG+IGGPDKGRRP + DN HP Sbjct: 417 EEKERARARQRQFETWGIIGGPDKGRRPTQ-------NDDNVSHP 454 >ref|XP_004235230.1| PREDICTED: rhodanese-like domain-containing protein 7 [Solanum lycopersicum] Length = 476 Score = 62.0 bits (149), Expect = 2e-07 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +3 Query: 3 EEKDRARARQRQFEAWGVIGGPDKGRRPVKAVD 101 EEK+RARARQ QFE WG+IGGPDKGRRP K VD Sbjct: 431 EEKERARARQSQFERWGIIGGPDKGRRPPKTVD 463 >ref|XP_006842503.2| PREDICTED: rhodanese-like domain-containing protein 7 [Amborella trichopoda] Length = 474 Score = 61.6 bits (148), Expect = 2e-07 Identities = 29/39 (74%), Positives = 32/39 (82%), Gaps = 2/39 (5%) Frame = +3 Query: 3 EEKDRARARQRQFEAWGVIGGPDKGRRP--VKAVDDGNS 113 EEK RARARQRQFE WG+IGGPDKGRRP V +DGN+ Sbjct: 430 EEKARARARQRQFETWGIIGGPDKGRRPISVNPEEDGNA 468 >gb|ERN04178.1| hypothetical protein AMTR_s00077p00102160 [Amborella trichopoda] Length = 415 Score = 61.6 bits (148), Expect = 2e-07 Identities = 29/39 (74%), Positives = 32/39 (82%), Gaps = 2/39 (5%) Frame = +3 Query: 3 EEKDRARARQRQFEAWGVIGGPDKGRRP--VKAVDDGNS 113 EEK RARARQRQFE WG+IGGPDKGRRP V +DGN+ Sbjct: 371 EEKARARARQRQFETWGIIGGPDKGRRPISVNPEEDGNA 409 >ref|XP_010938023.1| PREDICTED: rhodanese-like domain-containing protein 7 [Elaeis guineensis] Length = 474 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/43 (65%), Positives = 31/43 (72%) Frame = +3 Query: 3 EEKDRARARQRQFEAWGVIGGPDKGRRPVKAVDDGNSTGDNHQ 131 EEK+RARARQRQFE WGVIGGPDKGRR + N NH+ Sbjct: 428 EEKERARARQRQFETWGVIGGPDKGRRDPARFETDNDRKANHR 470 >ref|XP_012091126.1| PREDICTED: rhodanese-like domain-containing protein 7 isoform X2 [Jatropha curcas] Length = 446 Score = 60.8 bits (146), Expect = 4e-07 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = +3 Query: 3 EEKDRARARQRQFEAWGVIGGPDKGRRPVKAVD 101 EEK+RARARQRQFE WG+IGGPDKGRRP D Sbjct: 401 EEKERARARQRQFETWGIIGGPDKGRRPTSKPD 433