BLASTX nr result
ID: Papaver31_contig00038478
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00038478 (603 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHG10681.1| Splicing factor, suppressor of white-apricot [Gos... 57 8e-06 >gb|KHG10681.1| Splicing factor, suppressor of white-apricot [Gossypium arboreum] Length = 992 Score = 57.0 bits (136), Expect = 8e-06 Identities = 28/52 (53%), Positives = 35/52 (67%) Frame = -1 Query: 411 NSGEGQGAGGTYSAVGFSYGNSAAGQKNSDSMVGDYGFRPPFPVPENLLQSL 256 N+ E AGG Y+AV FSYGN+ + D+ V + FRPPFPVPE LLQ+L Sbjct: 199 NNEEPAAAGGLYNAVSFSYGNTGESNEQKDADV-ESSFRPPFPVPETLLQNL 249