BLASTX nr result
ID: Papaver31_contig00038392
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00038392 (447 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012847743.1| PREDICTED: single-stranded DNA-binding prote... 57 4e-06 gb|EYU28713.1| hypothetical protein MIMGU_mgv1a009792mg [Erythra... 57 4e-06 ref|XP_004297331.1| PREDICTED: single-stranded DNA-binding prote... 57 4e-06 >ref|XP_012847743.1| PREDICTED: single-stranded DNA-binding protein WHY1, chloroplastic [Erythranthe guttatus] Length = 284 Score = 57.4 bits (137), Expect = 4e-06 Identities = 23/44 (52%), Positives = 34/44 (77%) Frame = -3 Query: 445 SYILPYLLGWHTFVNSVKPSDTSRVNNNTNMHSRAETADLEWSK 314 ++++PYLLGWHTF NS+KP D++RVN + + R+ T D EWS+ Sbjct: 244 NFVIPYLLGWHTFANSIKPEDSNRVN---SANPRSGTVDYEWSR 284 >gb|EYU28713.1| hypothetical protein MIMGU_mgv1a009792mg [Erythranthe guttata] Length = 331 Score = 57.4 bits (137), Expect = 4e-06 Identities = 23/44 (52%), Positives = 34/44 (77%) Frame = -3 Query: 445 SYILPYLLGWHTFVNSVKPSDTSRVNNNTNMHSRAETADLEWSK 314 ++++PYLLGWHTF NS+KP D++RVN + + R+ T D EWS+ Sbjct: 291 NFVIPYLLGWHTFANSIKPEDSNRVN---SANPRSGTVDYEWSR 331 >ref|XP_004297331.1| PREDICTED: single-stranded DNA-binding protein WHY1, chloroplastic [Fragaria vesca subsp. vesca] Length = 270 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/44 (56%), Positives = 31/44 (70%) Frame = -3 Query: 445 SYILPYLLGWHTFVNSVKPSDTSRVNNNTNMHSRAETADLEWSK 314 +Y+LPYL+GWH +VNSVKP D SRVNN T + D EWS+ Sbjct: 231 NYLLPYLIGWHAYVNSVKPEDMSRVNNATPRYG----GDFEWSR 270