BLASTX nr result
ID: Papaver31_contig00038339
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00038339 (638 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010105725.1| Trafficking protein particle complex subunit... 112 1e-22 emb|CDP05126.1| unnamed protein product [Coffea canephora] 112 1e-22 ref|XP_011084468.1| PREDICTED: trafficking protein particle comp... 111 3e-22 ref|XP_010662666.1| PREDICTED: trafficking protein particle comp... 110 5e-22 ref|XP_012488565.1| PREDICTED: trafficking protein particle comp... 110 7e-22 ref|XP_006304254.1| hypothetical protein CARUB_v10010477mg [Caps... 110 7e-22 ref|XP_010544230.1| PREDICTED: trafficking protein particle comp... 110 9e-22 ref|XP_013640766.1| PREDICTED: trafficking protein particle comp... 109 1e-21 ref|XP_010272512.1| PREDICTED: trafficking protein particle comp... 109 1e-21 ref|XP_009147779.1| PREDICTED: trafficking protein particle comp... 109 1e-21 gb|KFK35876.1| hypothetical protein AALP_AA4G048300 [Arabis alpina] 109 1e-21 ref|NP_175528.1| Sybindin-like domain-containing protein [Arabid... 109 1e-21 ref|XP_007038857.1| SNARE-like superfamily protein isoform 5 [Th... 109 1e-21 ref|XP_007038853.1| SNARE-like superfamily protein isoform 1 [Th... 109 1e-21 ref|XP_014521402.1| PREDICTED: trafficking protein particle comp... 109 2e-21 gb|KOM44817.1| hypothetical protein LR48_Vigan06g012300 [Vigna a... 109 2e-21 ref|XP_008437540.1| PREDICTED: trafficking protein particle comp... 108 2e-21 ref|XP_012090163.1| PREDICTED: trafficking protein particle comp... 108 2e-21 ref|XP_006372361.1| synbindin family protein [Populus trichocarp... 108 2e-21 ref|XP_004145907.1| PREDICTED: trafficking protein particle comp... 108 2e-21 >ref|XP_010105725.1| Trafficking protein particle complex subunit 1 [Morus notabilis] gi|587918439|gb|EXC05945.1| Trafficking protein particle complex subunit 1 [Morus notabilis] Length = 153 Score = 112 bits (281), Expect = 1e-22 Identities = 48/57 (84%), Positives = 54/57 (94%) Frame = -1 Query: 173 MQFFGGSEVSPSPPIPSGAGNRAHLMYVFNRNGVCLLYREWNRPLRTLSSQQDHKLM 3 MQFFGGSE+SPSPP+P+ +GN AH+MYVFNRNGVCLLYREWNRPLRTL+ QQDHKLM Sbjct: 1 MQFFGGSEISPSPPVPTASGNNAHMMYVFNRNGVCLLYREWNRPLRTLNPQQDHKLM 57 >emb|CDP05126.1| unnamed protein product [Coffea canephora] Length = 169 Score = 112 bits (281), Expect = 1e-22 Identities = 48/57 (84%), Positives = 54/57 (94%) Frame = -1 Query: 173 MQFFGGSEVSPSPPIPSGAGNRAHLMYVFNRNGVCLLYREWNRPLRTLSSQQDHKLM 3 MQFFGGSE+SPSPP+P+ AGN AH++YVFNRNGVCLLYREWNRPL+TLS QQDHKLM Sbjct: 1 MQFFGGSEISPSPPVPTAAGNNAHMLYVFNRNGVCLLYREWNRPLKTLSPQQDHKLM 57 >ref|XP_011084468.1| PREDICTED: trafficking protein particle complex subunit 1 [Sesamum indicum] Length = 169 Score = 111 bits (278), Expect = 3e-22 Identities = 47/57 (82%), Positives = 54/57 (94%) Frame = -1 Query: 173 MQFFGGSEVSPSPPIPSGAGNRAHLMYVFNRNGVCLLYREWNRPLRTLSSQQDHKLM 3 MQFFGGSE+SPSPP P+ +GN AH++Y+FNRNGVCLLYREWNRPL+TLSSQQDHKLM Sbjct: 1 MQFFGGSEISPSPPAPAASGNNAHMLYIFNRNGVCLLYREWNRPLKTLSSQQDHKLM 57 >ref|XP_010662666.1| PREDICTED: trafficking protein particle complex subunit 1 isoform X1 [Vitis vinifera] gi|147834231|emb|CAN66358.1| hypothetical protein VITISV_016122 [Vitis vinifera] gi|302143758|emb|CBI22619.3| unnamed protein product [Vitis vinifera] Length = 169 Score = 110 bits (276), Expect = 5e-22 Identities = 47/57 (82%), Positives = 54/57 (94%) Frame = -1 Query: 173 MQFFGGSEVSPSPPIPSGAGNRAHLMYVFNRNGVCLLYREWNRPLRTLSSQQDHKLM 3 MQFFGGSE+SP PP+P+ +GN AH+MYVFNRNGVCLLYREWNRPLRTL++QQDHKLM Sbjct: 1 MQFFGGSEISPLPPLPTASGNNAHMMYVFNRNGVCLLYREWNRPLRTLNAQQDHKLM 57 >ref|XP_012488565.1| PREDICTED: trafficking protein particle complex subunit 1 [Gossypium raimondii] gi|728845351|gb|KHG24794.1| Trafficking particle complex subunit 1 [Gossypium arboreum] gi|763772312|gb|KJB39435.1| hypothetical protein B456_007G013500 [Gossypium raimondii] gi|763772313|gb|KJB39436.1| hypothetical protein B456_007G013500 [Gossypium raimondii] Length = 169 Score = 110 bits (275), Expect = 7e-22 Identities = 47/57 (82%), Positives = 52/57 (91%) Frame = -1 Query: 173 MQFFGGSEVSPSPPIPSGAGNRAHLMYVFNRNGVCLLYREWNRPLRTLSSQQDHKLM 3 MQFFGGSE+SPSPP+P+ GN AH+MYVFNRNGVCLLYREWNRPL TL+ QQDHKLM Sbjct: 1 MQFFGGSEISPSPPVPTATGNNAHMMYVFNRNGVCLLYREWNRPLHTLNPQQDHKLM 57 >ref|XP_006304254.1| hypothetical protein CARUB_v10010477mg [Capsella rubella] gi|482572965|gb|EOA37152.1| hypothetical protein CARUB_v10010477mg [Capsella rubella] Length = 169 Score = 110 bits (275), Expect = 7e-22 Identities = 46/57 (80%), Positives = 54/57 (94%) Frame = -1 Query: 173 MQFFGGSEVSPSPPIPSGAGNRAHLMYVFNRNGVCLLYREWNRPLRTLSSQQDHKLM 3 MQFFGGSE+SPSPP+P+ +GN AH+MYVFNRNGVCLLY+EWNRPL TL++QQDHKLM Sbjct: 1 MQFFGGSEISPSPPVPTASGNNAHMMYVFNRNGVCLLYKEWNRPLHTLNAQQDHKLM 57 >ref|XP_010544230.1| PREDICTED: trafficking protein particle complex subunit 1 [Tarenaya hassleriana] Length = 169 Score = 110 bits (274), Expect = 9e-22 Identities = 45/57 (78%), Positives = 54/57 (94%) Frame = -1 Query: 173 MQFFGGSEVSPSPPIPSGAGNRAHLMYVFNRNGVCLLYREWNRPLRTLSSQQDHKLM 3 MQFFGGSE+SPSPP+P+ +GN AH++YVFNRNG+CLLYREWNRPL TL++QQDHKLM Sbjct: 1 MQFFGGSEISPSPPVPTASGNNAHMLYVFNRNGICLLYREWNRPLHTLNAQQDHKLM 57 >ref|XP_013640766.1| PREDICTED: trafficking protein particle complex subunit 1 [Brassica napus] Length = 169 Score = 109 bits (273), Expect = 1e-21 Identities = 46/57 (80%), Positives = 53/57 (92%) Frame = -1 Query: 173 MQFFGGSEVSPSPPIPSGAGNRAHLMYVFNRNGVCLLYREWNRPLRTLSSQQDHKLM 3 MQFFGGSE+SPSPP+P+ +GN AH+MYVFNRNGVCLLY+EWNRPL TL+ QQDHKLM Sbjct: 1 MQFFGGSEISPSPPVPTASGNNAHMMYVFNRNGVCLLYKEWNRPLHTLNPQQDHKLM 57 >ref|XP_010272512.1| PREDICTED: trafficking protein particle complex subunit 1 [Nelumbo nucifera] gi|720052754|ref|XP_010272514.1| PREDICTED: trafficking protein particle complex subunit 1 [Nelumbo nucifera] Length = 169 Score = 109 bits (273), Expect = 1e-21 Identities = 46/57 (80%), Positives = 54/57 (94%) Frame = -1 Query: 173 MQFFGGSEVSPSPPIPSGAGNRAHLMYVFNRNGVCLLYREWNRPLRTLSSQQDHKLM 3 MQFFGGSE+SP+P P+G+GN AH+MY+FNRNGVCLLYREWNRPLRTL++QQDHKLM Sbjct: 1 MQFFGGSEISPAPSAPTGSGNNAHMMYIFNRNGVCLLYREWNRPLRTLNAQQDHKLM 57 >ref|XP_009147779.1| PREDICTED: trafficking protein particle complex subunit 1 [Brassica rapa] gi|922506198|ref|XP_013589983.1| PREDICTED: trafficking protein particle complex subunit 1 [Brassica oleracea var. oleracea] gi|923925330|ref|XP_013731671.1| PREDICTED: trafficking protein particle complex subunit 1-like [Brassica napus] gi|674907906|emb|CDY25215.1| BnaC06g04400D [Brassica napus] gi|674910284|emb|CDY22829.1| BnaA06g02480D [Brassica napus] Length = 169 Score = 109 bits (273), Expect = 1e-21 Identities = 46/57 (80%), Positives = 53/57 (92%) Frame = -1 Query: 173 MQFFGGSEVSPSPPIPSGAGNRAHLMYVFNRNGVCLLYREWNRPLRTLSSQQDHKLM 3 MQFFGGSE+SPSPP+P+ +GN AH+MYVFNRNGVCLLY+EWNRPL TL+ QQDHKLM Sbjct: 1 MQFFGGSEISPSPPVPTASGNNAHMMYVFNRNGVCLLYKEWNRPLHTLNPQQDHKLM 57 >gb|KFK35876.1| hypothetical protein AALP_AA4G048300 [Arabis alpina] Length = 169 Score = 109 bits (273), Expect = 1e-21 Identities = 46/57 (80%), Positives = 53/57 (92%) Frame = -1 Query: 173 MQFFGGSEVSPSPPIPSGAGNRAHLMYVFNRNGVCLLYREWNRPLRTLSSQQDHKLM 3 MQFFGGSE+SPSPP+P+ +GN AH+MYVFNRNGVCLLY+EWNRPL TL+ QQDHKLM Sbjct: 1 MQFFGGSEISPSPPVPTASGNNAHMMYVFNRNGVCLLYKEWNRPLHTLNPQQDHKLM 57 >ref|NP_175528.1| Sybindin-like domain-containing protein [Arabidopsis thaliana] gi|79319655|ref|NP_001031168.1| Sybindin-like domain-containing protein [Arabidopsis thaliana] gi|297847478|ref|XP_002891620.1| hypothetical protein ARALYDRAFT_892078 [Arabidopsis lyrata subsp. lyrata] gi|727438669|ref|XP_010500686.1| PREDICTED: trafficking protein particle complex subunit 1-like [Camelina sativa] gi|727578549|ref|XP_010461948.1| PREDICTED: trafficking protein particle complex subunit 1-like [Camelina sativa] gi|727613563|ref|XP_010479575.1| PREDICTED: trafficking protein particle complex subunit 1-like [Camelina sativa] gi|4836927|gb|AAD30629.1|AC006085_2 Unknown protein [Arabidopsis thaliana] gi|12320789|gb|AAG50544.1|AC079828_15 unknown protein [Arabidopsis thaliana] gi|28466907|gb|AAO44062.1| At1g51160 [Arabidopsis thaliana] gi|110743933|dbj|BAE99800.1| hypothetical protein [Arabidopsis thaliana] gi|297337462|gb|EFH67879.1| hypothetical protein ARALYDRAFT_892078 [Arabidopsis lyrata subsp. lyrata] gi|332194507|gb|AEE32628.1| Sybindin-like domain-containing protein [Arabidopsis thaliana] gi|332194508|gb|AEE32629.1| Sybindin-like domain-containing protein [Arabidopsis thaliana] Length = 169 Score = 109 bits (273), Expect = 1e-21 Identities = 46/57 (80%), Positives = 53/57 (92%) Frame = -1 Query: 173 MQFFGGSEVSPSPPIPSGAGNRAHLMYVFNRNGVCLLYREWNRPLRTLSSQQDHKLM 3 MQFFGGSE+SPSPP+P+ +GN AH+MYVFNRNGVCLLY+EWNRPL TL+ QQDHKLM Sbjct: 1 MQFFGGSEISPSPPVPTASGNNAHMMYVFNRNGVCLLYKEWNRPLHTLNPQQDHKLM 57 >ref|XP_007038857.1| SNARE-like superfamily protein isoform 5 [Theobroma cacao] gi|508776102|gb|EOY23358.1| SNARE-like superfamily protein isoform 5 [Theobroma cacao] Length = 153 Score = 109 bits (273), Expect = 1e-21 Identities = 47/57 (82%), Positives = 52/57 (91%) Frame = -1 Query: 173 MQFFGGSEVSPSPPIPSGAGNRAHLMYVFNRNGVCLLYREWNRPLRTLSSQQDHKLM 3 MQFFGGSE+SPSPP+P+ GN AH+MYVFNRNGVCLLYREWNRPL TL+ QQDHKLM Sbjct: 1 MQFFGGSEISPSPPVPTTTGNNAHMMYVFNRNGVCLLYREWNRPLHTLNPQQDHKLM 57 >ref|XP_007038853.1| SNARE-like superfamily protein isoform 1 [Theobroma cacao] gi|590673305|ref|XP_007038854.1| SNARE-like superfamily protein isoform 1 [Theobroma cacao] gi|590673308|ref|XP_007038855.1| SNARE-like superfamily protein isoform 1 [Theobroma cacao] gi|590673312|ref|XP_007038856.1| SNARE-like superfamily protein isoform 1 [Theobroma cacao] gi|508776098|gb|EOY23354.1| SNARE-like superfamily protein isoform 1 [Theobroma cacao] gi|508776099|gb|EOY23355.1| SNARE-like superfamily protein isoform 1 [Theobroma cacao] gi|508776100|gb|EOY23356.1| SNARE-like superfamily protein isoform 1 [Theobroma cacao] gi|508776101|gb|EOY23357.1| SNARE-like superfamily protein isoform 1 [Theobroma cacao] Length = 169 Score = 109 bits (273), Expect = 1e-21 Identities = 47/57 (82%), Positives = 52/57 (91%) Frame = -1 Query: 173 MQFFGGSEVSPSPPIPSGAGNRAHLMYVFNRNGVCLLYREWNRPLRTLSSQQDHKLM 3 MQFFGGSE+SPSPP+P+ GN AH+MYVFNRNGVCLLYREWNRPL TL+ QQDHKLM Sbjct: 1 MQFFGGSEISPSPPVPTTTGNNAHMMYVFNRNGVCLLYREWNRPLHTLNPQQDHKLM 57 >ref|XP_014521402.1| PREDICTED: trafficking protein particle complex subunit 1 [Vigna radiata var. radiata] gi|951055171|ref|XP_014521403.1| PREDICTED: trafficking protein particle complex subunit 1 [Vigna radiata var. radiata] Length = 170 Score = 109 bits (272), Expect = 2e-21 Identities = 47/57 (82%), Positives = 51/57 (89%) Frame = -1 Query: 173 MQFFGGSEVSPSPPIPSGAGNRAHLMYVFNRNGVCLLYREWNRPLRTLSSQQDHKLM 3 MQFFGGSE+SPSPP P+ GN H+MYVFNRNGVCLLYREWNRPLRTL +QQDHKLM Sbjct: 1 MQFFGGSEISPSPPAPAAPGNNGHMMYVFNRNGVCLLYREWNRPLRTLDAQQDHKLM 57 >gb|KOM44817.1| hypothetical protein LR48_Vigan06g012300 [Vigna angularis] Length = 154 Score = 109 bits (272), Expect = 2e-21 Identities = 47/57 (82%), Positives = 51/57 (89%) Frame = -1 Query: 173 MQFFGGSEVSPSPPIPSGAGNRAHLMYVFNRNGVCLLYREWNRPLRTLSSQQDHKLM 3 MQFFGGSE+SPSPP P+ GN H+MYVFNRNGVCLLYREWNRPLRTL +QQDHKLM Sbjct: 1 MQFFGGSEISPSPPAPAAPGNNGHMMYVFNRNGVCLLYREWNRPLRTLDAQQDHKLM 57 >ref|XP_008437540.1| PREDICTED: trafficking protein particle complex subunit 1 [Cucumis melo] gi|659074320|ref|XP_008437541.1| PREDICTED: trafficking protein particle complex subunit 1 [Cucumis melo] gi|659074322|ref|XP_008437542.1| PREDICTED: trafficking protein particle complex subunit 1 [Cucumis melo] Length = 169 Score = 108 bits (271), Expect = 2e-21 Identities = 45/57 (78%), Positives = 51/57 (89%) Frame = -1 Query: 173 MQFFGGSEVSPSPPIPSGAGNRAHLMYVFNRNGVCLLYREWNRPLRTLSSQQDHKLM 3 MQFFGGSE+SPSPP+P+ GN H+MY+FNRNGVCL YREWNRPLRTL+ QQDHKLM Sbjct: 1 MQFFGGSEISPSPPVPTATGNNVHMMYIFNRNGVCLFYREWNRPLRTLNPQQDHKLM 57 >ref|XP_012090163.1| PREDICTED: trafficking protein particle complex subunit 1 [Jatropha curcas] gi|643706074|gb|KDP22206.1| hypothetical protein JCGZ_26037 [Jatropha curcas] Length = 169 Score = 108 bits (271), Expect = 2e-21 Identities = 46/57 (80%), Positives = 53/57 (92%) Frame = -1 Query: 173 MQFFGGSEVSPSPPIPSGAGNRAHLMYVFNRNGVCLLYREWNRPLRTLSSQQDHKLM 3 MQFFGGS++SPSPP P+ +GN AH+MYVFNRNGVCLLYREWNRPL TL++QQDHKLM Sbjct: 1 MQFFGGSDISPSPPAPTASGNNAHMMYVFNRNGVCLLYREWNRPLHTLNAQQDHKLM 57 >ref|XP_006372361.1| synbindin family protein [Populus trichocarpa] gi|550318979|gb|ERP50158.1| synbindin family protein [Populus trichocarpa] Length = 169 Score = 108 bits (271), Expect = 2e-21 Identities = 46/57 (80%), Positives = 53/57 (92%) Frame = -1 Query: 173 MQFFGGSEVSPSPPIPSGAGNRAHLMYVFNRNGVCLLYREWNRPLRTLSSQQDHKLM 3 MQFFGGS++SPSPP P+ +GN AH+MYVFNRNGVCLLYREWNRPL TL++QQDHKLM Sbjct: 1 MQFFGGSDISPSPPAPTASGNNAHMMYVFNRNGVCLLYREWNRPLHTLNAQQDHKLM 57 >ref|XP_004145907.1| PREDICTED: trafficking protein particle complex subunit 1 [Cucumis sativus] gi|700194737|gb|KGN49914.1| hypothetical protein Csa_5G139910 [Cucumis sativus] Length = 169 Score = 108 bits (271), Expect = 2e-21 Identities = 45/57 (78%), Positives = 51/57 (89%) Frame = -1 Query: 173 MQFFGGSEVSPSPPIPSGAGNRAHLMYVFNRNGVCLLYREWNRPLRTLSSQQDHKLM 3 MQFFGGSE+SPSPP+P+ GN H+MY+FNRNGVCL YREWNRPLRTL+ QQDHKLM Sbjct: 1 MQFFGGSEISPSPPVPTATGNNVHMMYIFNRNGVCLFYREWNRPLRTLNPQQDHKLM 57