BLASTX nr result
ID: Papaver31_contig00038195
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00038195 (480 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009795878.1| PREDICTED: FAD synthase-like [Nicotiana sylv... 57 7e-06 >ref|XP_009795878.1| PREDICTED: FAD synthase-like [Nicotiana sylvestris] gi|698500205|ref|XP_009795879.1| PREDICTED: FAD synthase-like [Nicotiana sylvestris] Length = 505 Score = 56.6 bits (135), Expect = 7e-06 Identities = 30/52 (57%), Positives = 35/52 (67%) Frame = +3 Query: 228 LPTEPLLQTNLIILSATNVDELDKQWDCLIGSESSSSQLKLMASFISGSLCT 383 LP + N+IIL+ATNV ELD QWDCLI S S+ L LMA F+S SL T Sbjct: 388 LPVPLIKCGNVIILTATNVAELDLQWDCLIESAKSNGDLVLMAPFVSKSLAT 439