BLASTX nr result
ID: Papaver31_contig00034877
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00034877 (475 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008658059.1| PREDICTED: uncharacterized protein LOC100192... 74 3e-11 ref|XP_009336163.1| PREDICTED: homogentisate 1,2-dioxygenase [Py... 74 4e-11 gb|KNA10783.1| hypothetical protein SOVF_141140 [Spinacia oleracea] 74 6e-11 ref|XP_010537038.1| PREDICTED: homogentisate 1,2-dioxygenase [Ta... 74 6e-11 ref|XP_013620845.1| PREDICTED: homogentisate 1,2-dioxygenase [Br... 73 7e-11 ref|NP_200219.1| homogentisate 1,2-dioxygenase [Arabidopsis thal... 73 7e-11 ref|XP_010482815.1| PREDICTED: homogentisate 1,2-dioxygenase [Ca... 73 7e-11 ref|XP_010442982.1| PREDICTED: homogentisate 1,2-dioxygenase-lik... 73 7e-11 ref|XP_010446433.1| PREDICTED: homogentisate 1,2-dioxygenase-lik... 73 7e-11 ref|XP_009127119.1| PREDICTED: homogentisate 1,2-dioxygenase [Br... 73 7e-11 emb|CDY41772.1| BnaC02g13840D [Brassica napus] 73 7e-11 gb|KFK27018.1| hypothetical protein AALP_AA8G323800 [Arabis alpina] 73 7e-11 ref|XP_008784438.1| PREDICTED: homogentisate 1,2-dioxygenase [Ph... 73 7e-11 gb|AAD00360.1| homogentisate 1,2-dioxygenase [Arabidopsis thaliana] 73 7e-11 gb|AAM65958.1| homogentisate 1,2-dioxygenase [Arabidopsis thaliana] 73 7e-11 ref|XP_006401630.1| hypothetical protein EUTSA_v100136911mg, par... 73 7e-11 ref|XP_006280403.1| hypothetical protein CARUB_v10026329mg [Caps... 73 7e-11 ref|XP_002864301.1| homogentisate 1,2-dioxygenase [Arabidopsis l... 73 7e-11 gb|KJB13254.1| hypothetical protein B456_002G065000 [Gossypium r... 73 9e-11 gb|KJB13253.1| hypothetical protein B456_002G065000 [Gossypium r... 73 9e-11 >ref|XP_008658059.1| PREDICTED: uncharacterized protein LOC100192757 isoform X1 [Zea mays] Length = 488 Score = 74.3 bits (181), Expect = 3e-11 Identities = 31/47 (65%), Positives = 39/47 (82%) Frame = +3 Query: 180 MLNFVIFPPGWLIVGHTFRPPYHHCNCMSEFMDLIYGKHEVKPYLTL 320 +L+FVIFPP WL+ +TFRPPY+H NCMSEFM LIYG +EV YL++ Sbjct: 320 LLDFVIFPPRWLVAENTFRPPYYHRNCMSEFMGLIYGMYEVSIYLSI 366 >ref|XP_009336163.1| PREDICTED: homogentisate 1,2-dioxygenase [Pyrus x bretschneideri] Length = 472 Score = 73.9 bits (180), Expect = 4e-11 Identities = 30/42 (71%), Positives = 36/42 (85%) Frame = +3 Query: 180 MLNFVIFPPGWLIVGHTFRPPYHHCNCMSEFMDLIYGKHEVK 305 +L+FVIFPP WL+ HTFRPPY+H NCMSEFM LIYG++E K Sbjct: 331 LLDFVIFPPRWLVAEHTFRPPYYHRNCMSEFMGLIYGEYEAK 372 >gb|KNA10783.1| hypothetical protein SOVF_141140 [Spinacia oleracea] Length = 466 Score = 73.6 bits (179), Expect = 6e-11 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = +3 Query: 180 MLNFVIFPPGWLIVGHTFRPPYHHCNCMSEFMDLIYGKHEVK 305 +L+FVIFPP WL+ HTFRPPY+H NCMSEFM LIYG +E K Sbjct: 329 LLDFVIFPPRWLVAEHTFRPPYYHRNCMSEFMGLIYGNYEAK 370 >ref|XP_010537038.1| PREDICTED: homogentisate 1,2-dioxygenase [Tarenaya hassleriana] Length = 458 Score = 73.6 bits (179), Expect = 6e-11 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = +3 Query: 180 MLNFVIFPPGWLIVGHTFRPPYHHCNCMSEFMDLIYGKHEVK 305 +L+FVIFPP WL+ HTFRPPY+H NCMSEFM LIYG +E K Sbjct: 315 LLDFVIFPPRWLVAEHTFRPPYYHRNCMSEFMGLIYGSYEAK 356 >ref|XP_013620845.1| PREDICTED: homogentisate 1,2-dioxygenase [Brassica oleracea var. oleracea] gi|923757667|ref|XP_013676249.1| PREDICTED: homogentisate 1,2-dioxygenase-like [Brassica napus] Length = 458 Score = 73.2 bits (178), Expect = 7e-11 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = +3 Query: 180 MLNFVIFPPGWLIVGHTFRPPYHHCNCMSEFMDLIYGKHEVK 305 +L+FVIFPP WL+ HTFRPPY+H NCMSEFM LIYG +E K Sbjct: 315 LLDFVIFPPRWLVAEHTFRPPYYHRNCMSEFMGLIYGAYEAK 356 >ref|NP_200219.1| homogentisate 1,2-dioxygenase [Arabidopsis thaliana] gi|30696407|ref|NP_851187.1| homogentisate 1,2-dioxygenase [Arabidopsis thaliana] gi|13432134|sp|Q9ZRA2.2|HGD_ARATH RecName: Full=Homogentisate 1,2-dioxygenase; AltName: Full=Homogentisate oxygenase; AltName: Full=Homogentisic acid oxidase; AltName: Full=Homogentisicase gi|7108615|gb|AAF36499.1|AF130845_1 homogentisate 1,2-dioxygenase [Arabidopsis thaliana] gi|8809579|dbj|BAA97130.1| homogentisate 1,2-dioxygenase [Arabidopsis thaliana] gi|22655252|gb|AAM98216.1| homogentisate 1,2-dioxygenase [Arabidopsis thaliana] gi|33942055|gb|AAQ55280.1| At5g54080 [Arabidopsis thaliana] gi|332009064|gb|AED96447.1| homogentisate 1,2-dioxygenase [Arabidopsis thaliana] gi|332009065|gb|AED96448.1| homogentisate 1,2-dioxygenase [Arabidopsis thaliana] Length = 461 Score = 73.2 bits (178), Expect = 7e-11 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = +3 Query: 180 MLNFVIFPPGWLIVGHTFRPPYHHCNCMSEFMDLIYGKHEVK 305 +L+FVIFPP WL+ HTFRPPY+H NCMSEFM LIYG +E K Sbjct: 318 LLDFVIFPPRWLVAEHTFRPPYYHRNCMSEFMGLIYGAYEAK 359 >ref|XP_010482815.1| PREDICTED: homogentisate 1,2-dioxygenase [Camelina sativa] Length = 462 Score = 73.2 bits (178), Expect = 7e-11 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = +3 Query: 180 MLNFVIFPPGWLIVGHTFRPPYHHCNCMSEFMDLIYGKHEVK 305 +L+FVIFPP WL+ HTFRPPY+H NCMSEFM LIYG +E K Sbjct: 319 LLDFVIFPPRWLVAEHTFRPPYYHRNCMSEFMGLIYGAYEAK 360 >ref|XP_010442982.1| PREDICTED: homogentisate 1,2-dioxygenase-like [Camelina sativa] Length = 461 Score = 73.2 bits (178), Expect = 7e-11 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = +3 Query: 180 MLNFVIFPPGWLIVGHTFRPPYHHCNCMSEFMDLIYGKHEVK 305 +L+FVIFPP WL+ HTFRPPY+H NCMSEFM LIYG +E K Sbjct: 318 LLDFVIFPPRWLVAEHTFRPPYYHRNCMSEFMGLIYGAYEAK 359 >ref|XP_010446433.1| PREDICTED: homogentisate 1,2-dioxygenase-like [Camelina sativa] Length = 461 Score = 73.2 bits (178), Expect = 7e-11 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = +3 Query: 180 MLNFVIFPPGWLIVGHTFRPPYHHCNCMSEFMDLIYGKHEVK 305 +L+FVIFPP WL+ HTFRPPY+H NCMSEFM LIYG +E K Sbjct: 318 LLDFVIFPPRWLVAEHTFRPPYYHRNCMSEFMGLIYGAYEAK 359 >ref|XP_009127119.1| PREDICTED: homogentisate 1,2-dioxygenase [Brassica rapa] gi|923527021|ref|XP_013686130.1| PREDICTED: homogentisate 1,2-dioxygenase [Brassica napus] gi|674904242|emb|CDY28797.1| BnaA02g09890D [Brassica napus] Length = 452 Score = 73.2 bits (178), Expect = 7e-11 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = +3 Query: 180 MLNFVIFPPGWLIVGHTFRPPYHHCNCMSEFMDLIYGKHEVK 305 +L+FVIFPP WL+ HTFRPPY+H NCMSEFM LIYG +E K Sbjct: 315 LLDFVIFPPRWLVAEHTFRPPYYHRNCMSEFMGLIYGAYEAK 356 >emb|CDY41772.1| BnaC02g13840D [Brassica napus] Length = 458 Score = 73.2 bits (178), Expect = 7e-11 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = +3 Query: 180 MLNFVIFPPGWLIVGHTFRPPYHHCNCMSEFMDLIYGKHEVK 305 +L+FVIFPP WL+ HTFRPPY+H NCMSEFM LIYG +E K Sbjct: 315 LLDFVIFPPRWLVAEHTFRPPYYHRNCMSEFMGLIYGAYEAK 356 >gb|KFK27018.1| hypothetical protein AALP_AA8G323800 [Arabis alpina] Length = 462 Score = 73.2 bits (178), Expect = 7e-11 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = +3 Query: 180 MLNFVIFPPGWLIVGHTFRPPYHHCNCMSEFMDLIYGKHEVK 305 +L+FVIFPP WL+ HTFRPPY+H NCMSEFM LIYG +E K Sbjct: 319 LLDFVIFPPRWLVAEHTFRPPYYHRNCMSEFMGLIYGAYEAK 360 >ref|XP_008784438.1| PREDICTED: homogentisate 1,2-dioxygenase [Phoenix dactylifera] Length = 464 Score = 73.2 bits (178), Expect = 7e-11 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = +3 Query: 180 MLNFVIFPPGWLIVGHTFRPPYHHCNCMSEFMDLIYGKHEVK 305 +L+FVIFPP WL+ HTFRPPY+H NCMSEFM LIYG +E K Sbjct: 322 LLDFVIFPPRWLVAEHTFRPPYYHRNCMSEFMGLIYGTYEAK 363 >gb|AAD00360.1| homogentisate 1,2-dioxygenase [Arabidopsis thaliana] Length = 461 Score = 73.2 bits (178), Expect = 7e-11 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = +3 Query: 180 MLNFVIFPPGWLIVGHTFRPPYHHCNCMSEFMDLIYGKHEVK 305 +L+FVIFPP WL+ HTFRPPY+H NCMSEFM LIYG +E K Sbjct: 318 LLDFVIFPPRWLVAEHTFRPPYYHRNCMSEFMGLIYGAYEAK 359 >gb|AAM65958.1| homogentisate 1,2-dioxygenase [Arabidopsis thaliana] Length = 461 Score = 73.2 bits (178), Expect = 7e-11 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = +3 Query: 180 MLNFVIFPPGWLIVGHTFRPPYHHCNCMSEFMDLIYGKHEVK 305 +L+FVIFPP WL+ HTFRPPY+H NCMSEFM LIYG +E K Sbjct: 318 LLDFVIFPPRWLVAEHTFRPPYYHRNCMSEFMGLIYGAYEAK 359 >ref|XP_006401630.1| hypothetical protein EUTSA_v100136911mg, partial [Eutrema salsugineum] gi|557102720|gb|ESQ43083.1| hypothetical protein EUTSA_v100136911mg, partial [Eutrema salsugineum] Length = 179 Score = 73.2 bits (178), Expect = 7e-11 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = +3 Query: 180 MLNFVIFPPGWLIVGHTFRPPYHHCNCMSEFMDLIYGKHEVK 305 +L+FVIFPP WL+ HTFRPPY+H NCMSEFM LIYG +E K Sbjct: 36 LLDFVIFPPRWLVAEHTFRPPYYHRNCMSEFMGLIYGAYEAK 77 >ref|XP_006280403.1| hypothetical protein CARUB_v10026329mg [Capsella rubella] gi|482549107|gb|EOA13301.1| hypothetical protein CARUB_v10026329mg [Capsella rubella] Length = 476 Score = 73.2 bits (178), Expect = 7e-11 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = +3 Query: 180 MLNFVIFPPGWLIVGHTFRPPYHHCNCMSEFMDLIYGKHEVK 305 +L+FVIFPP WL+ HTFRPPY+H NCMSEFM LIYG +E K Sbjct: 333 LLDFVIFPPRWLVAEHTFRPPYYHRNCMSEFMGLIYGAYEAK 374 >ref|XP_002864301.1| homogentisate 1,2-dioxygenase [Arabidopsis lyrata subsp. lyrata] gi|297310136|gb|EFH40560.1| homogentisate 1,2-dioxygenase [Arabidopsis lyrata subsp. lyrata] Length = 461 Score = 73.2 bits (178), Expect = 7e-11 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = +3 Query: 180 MLNFVIFPPGWLIVGHTFRPPYHHCNCMSEFMDLIYGKHEVK 305 +L+FVIFPP WL+ HTFRPPY+H NCMSEFM LIYG +E K Sbjct: 318 LLDFVIFPPRWLVAEHTFRPPYYHRNCMSEFMGLIYGAYEAK 359 >gb|KJB13254.1| hypothetical protein B456_002G065000 [Gossypium raimondii] Length = 457 Score = 72.8 bits (177), Expect = 9e-11 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = +3 Query: 180 MLNFVIFPPGWLIVGHTFRPPYHHCNCMSEFMDLIYGKHEVK 305 +L+FVIFPP WL+ HTFRPPY+H NCMSEFM LIYG +E K Sbjct: 316 LLDFVIFPPRWLVAEHTFRPPYYHRNCMSEFMGLIYGGYEAK 357 >gb|KJB13253.1| hypothetical protein B456_002G065000 [Gossypium raimondii] Length = 313 Score = 72.8 bits (177), Expect = 9e-11 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = +3 Query: 180 MLNFVIFPPGWLIVGHTFRPPYHHCNCMSEFMDLIYGKHEVK 305 +L+FVIFPP WL+ HTFRPPY+H NCMSEFM LIYG +E K Sbjct: 172 LLDFVIFPPRWLVAEHTFRPPYYHRNCMSEFMGLIYGGYEAK 213