BLASTX nr result
ID: Papaver31_contig00034427
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00034427 (835 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009795017.1| PREDICTED: hexokinase-2-like [Nicotiana sylv... 59 4e-06 gb|AAS60196.1| hexokinase 4b [Nicotiana tabacum] 59 4e-06 >ref|XP_009795017.1| PREDICTED: hexokinase-2-like [Nicotiana sylvestris] Length = 498 Score = 58.9 bits (141), Expect = 4e-06 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -3 Query: 707 ELGFNFSFPVKQLLIASGTLIKWTKGLFIDEAV 609 ELGF FSFPVKQL IASGTLIKWTKG ID+AV Sbjct: 172 ELGFTFSFPVKQLSIASGTLIKWTKGFSIDDAV 204 >gb|AAS60196.1| hexokinase 4b [Nicotiana tabacum] Length = 498 Score = 58.9 bits (141), Expect = 4e-06 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -3 Query: 707 ELGFNFSFPVKQLLIASGTLIKWTKGLFIDEAV 609 ELGF FSFPVKQL IASGTLIKWTKG ID+AV Sbjct: 172 ELGFTFSFPVKQLSIASGTLIKWTKGFSIDDAV 204