BLASTX nr result
ID: Papaver31_contig00034224
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00034224 (1116 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011468230.1| PREDICTED: uncharacterized protein LOC101312... 59 7e-06 >ref|XP_011468230.1| PREDICTED: uncharacterized protein LOC101312758 [Fragaria vesca subsp. vesca] Length = 800 Score = 58.9 bits (141), Expect = 7e-06 Identities = 27/45 (60%), Positives = 35/45 (77%) Frame = -2 Query: 1001 SLIVAPPTERIYIRAHMSAYREKDIMFAIRYKLDRGGQDFNVLPR 867 SLI PP ER+ IR H+SAY ++ ++ AI+Y+LDRGGQ F VLPR Sbjct: 422 SLISTPPPERVPIRTHLSAYSKEKVLSAIKYELDRGGQVFYVLPR 466