BLASTX nr result
ID: Papaver31_contig00033307
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00033307 (537 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011622299.1| PREDICTED: dual specificity protein phosphat... 49 6e-07 gb|ERN03334.1| hypothetical protein AMTR_s00003p00241010 [Ambore... 49 6e-07 >ref|XP_011622299.1| PREDICTED: dual specificity protein phosphatase PHS1 [Amborella trichopoda] Length = 903 Score = 48.5 bits (114), Expect(2) = 6e-07 Identities = 23/37 (62%), Positives = 28/37 (75%) Frame = +2 Query: 269 DLLRSLVLISKLHDINRYAKVDAELHSVLKQWNEMCK 379 D LRSL L +KL D N+YAK+DAEL L+QWNEM + Sbjct: 605 DPLRSLRLTTKLKDFNKYAKLDAELSKELEQWNEMLR 641 Score = 31.6 bits (70), Expect(2) = 6e-07 Identities = 17/30 (56%), Positives = 20/30 (66%) Frame = +1 Query: 166 SDPSHHRSSSTPGLYEIPDSASPIPRENLH 255 S+PS SSS+ E PDSASP+ REN H Sbjct: 569 SEPSFKSSSSSSK--ESPDSASPVSRENWH 596 >gb|ERN03334.1| hypothetical protein AMTR_s00003p00241010 [Amborella trichopoda] Length = 903 Score = 48.5 bits (114), Expect(2) = 6e-07 Identities = 23/37 (62%), Positives = 28/37 (75%) Frame = +2 Query: 269 DLLRSLVLISKLHDINRYAKVDAELHSVLKQWNEMCK 379 D LRSL L +KL D N+YAK+DAEL L+QWNEM + Sbjct: 605 DPLRSLRLTTKLKDFNKYAKLDAELSKELEQWNEMLR 641 Score = 31.6 bits (70), Expect(2) = 6e-07 Identities = 17/30 (56%), Positives = 20/30 (66%) Frame = +1 Query: 166 SDPSHHRSSSTPGLYEIPDSASPIPRENLH 255 S+PS SSS+ E PDSASP+ REN H Sbjct: 569 SEPSFKSSSSSSK--ESPDSASPVSRENWH 596