BLASTX nr result
ID: Papaver31_contig00033306
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00033306 (1359 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO70925.1| hypothetical protein CISIN_1g022196mg [Citrus sin... 75 2e-10 ref|XP_006492860.1| PREDICTED: probable plastid-lipid-associated... 75 2e-10 ref|XP_006429875.1| hypothetical protein CICLE_v10012319mg [Citr... 75 2e-10 ref|XP_002308366.2| hypothetical protein POPTR_0006s20660g [Popu... 73 7e-10 ref|XP_010928813.1| PREDICTED: probable plastid-lipid-associated... 72 1e-09 ref|XP_011004833.1| PREDICTED: probable plastid-lipid-associated... 71 2e-09 ref|XP_011004832.1| PREDICTED: probable plastid-lipid-associated... 71 2e-09 ref|XP_010265906.1| PREDICTED: probable plastid-lipid-associated... 70 3e-09 ref|XP_008782852.1| PREDICTED: probable plastid-lipid-associated... 70 4e-09 ref|XP_008782850.1| PREDICTED: probable plastid-lipid-associated... 70 4e-09 ref|XP_002322666.2| hypothetical protein POPTR_0016s04520g [Popu... 69 9e-09 ref|XP_012087764.1| PREDICTED: probable plastid-lipid-associated... 69 1e-08 gb|KDP24623.1| hypothetical protein JCGZ_25539 [Jatropha curcas] 69 1e-08 ref|XP_012087765.1| PREDICTED: probable plastid-lipid-associated... 68 2e-08 ref|XP_011033216.1| PREDICTED: probable plastid-lipid-associated... 68 2e-08 ref|XP_004960206.1| PREDICTED: probable plastid-lipid-associated... 67 3e-08 ref|XP_003580768.1| PREDICTED: probable plastid-lipid-associated... 67 4e-08 ref|XP_007028987.1| Plastid-lipid associated protein PAP / fibri... 67 5e-08 gb|KMT15317.1| hypothetical protein BVRB_3g060230 isoform B [Bet... 66 6e-08 ref|XP_002530706.1| conserved hypothetical protein [Ricinus comm... 66 6e-08 >gb|KDO70925.1| hypothetical protein CISIN_1g022196mg [Citrus sinensis] Length = 301 Score = 74.7 bits (182), Expect = 2e-10 Identities = 39/51 (76%), Positives = 41/51 (80%) Frame = -1 Query: 1308 SGTFQRLFMISYLDEEILIIRDAMGVPDVLTRLPAPLDPNDIIEPFAEYES 1156 SGTFQRLFMISYLDEEILIIRDA G+P+VLTRL P P I EP EYES Sbjct: 253 SGTFQRLFMISYLDEEILIIRDASGIPEVLTRLDPPSSP--IEEPITEYES 301 >ref|XP_006492860.1| PREDICTED: probable plastid-lipid-associated protein 13, chloroplastic-like isoform X1 [Citrus sinensis] Length = 301 Score = 74.7 bits (182), Expect = 2e-10 Identities = 39/51 (76%), Positives = 41/51 (80%) Frame = -1 Query: 1308 SGTFQRLFMISYLDEEILIIRDAMGVPDVLTRLPAPLDPNDIIEPFAEYES 1156 SGTFQRLFMISYLDEEILIIRDA G+P+VLTRL P P I EP EYES Sbjct: 253 SGTFQRLFMISYLDEEILIIRDASGIPEVLTRLDPPSSP--IEEPITEYES 301 >ref|XP_006429875.1| hypothetical protein CICLE_v10012319mg [Citrus clementina] gi|557531932|gb|ESR43115.1| hypothetical protein CICLE_v10012319mg [Citrus clementina] Length = 301 Score = 74.7 bits (182), Expect = 2e-10 Identities = 39/51 (76%), Positives = 41/51 (80%) Frame = -1 Query: 1308 SGTFQRLFMISYLDEEILIIRDAMGVPDVLTRLPAPLDPNDIIEPFAEYES 1156 SGTFQRLFMISYLDEEILIIRDA G+P+VLTRL P P I EP EYES Sbjct: 253 SGTFQRLFMISYLDEEILIIRDASGIPEVLTRLDPPSSP--IEEPITEYES 301 >ref|XP_002308366.2| hypothetical protein POPTR_0006s20660g [Populus trichocarpa] gi|550336740|gb|EEE91889.2| hypothetical protein POPTR_0006s20660g [Populus trichocarpa] Length = 309 Score = 72.8 bits (177), Expect = 7e-10 Identities = 37/51 (72%), Positives = 42/51 (82%) Frame = -1 Query: 1308 SGTFQRLFMISYLDEEILIIRDAMGVPDVLTRLPAPLDPNDIIEPFAEYES 1156 + TFQRLFMISYLD+EILI+RDA GVP+VLTRL AP P + EP AEYES Sbjct: 261 TSTFQRLFMISYLDDEILIVRDAAGVPEVLTRLDAPASP--MAEPTAEYES 309 >ref|XP_010928813.1| PREDICTED: probable plastid-lipid-associated protein 13, chloroplastic [Elaeis guineensis] Length = 301 Score = 71.6 bits (174), Expect = 1e-09 Identities = 36/51 (70%), Positives = 40/51 (78%) Frame = -1 Query: 1308 SGTFQRLFMISYLDEEILIIRDAMGVPDVLTRLPAPLDPNDIIEPFAEYES 1156 SGTFQRLFMISYLDEEILIIRD+ G PDVLTRL P P+ + +EYES Sbjct: 251 SGTFQRLFMISYLDEEILIIRDSAGAPDVLTRLDGPPAPSPMDPVISEYES 301 >ref|XP_011004833.1| PREDICTED: probable plastid-lipid-associated protein 13, chloroplastic isoform X2 [Populus euphratica] Length = 304 Score = 71.2 bits (173), Expect = 2e-09 Identities = 36/51 (70%), Positives = 41/51 (80%) Frame = -1 Query: 1308 SGTFQRLFMISYLDEEILIIRDAMGVPDVLTRLPAPLDPNDIIEPFAEYES 1156 + TFQRLFMISYLD+EILI+RDA G P+VLTRL AP P + EP AEYES Sbjct: 256 TSTFQRLFMISYLDDEILIVRDAAGAPEVLTRLDAPASP--MAEPTAEYES 304 >ref|XP_011004832.1| PREDICTED: probable plastid-lipid-associated protein 13, chloroplastic isoform X1 [Populus euphratica] Length = 311 Score = 71.2 bits (173), Expect = 2e-09 Identities = 36/51 (70%), Positives = 41/51 (80%) Frame = -1 Query: 1308 SGTFQRLFMISYLDEEILIIRDAMGVPDVLTRLPAPLDPNDIIEPFAEYES 1156 + TFQRLFMISYLD+EILI+RDA G P+VLTRL AP P + EP AEYES Sbjct: 263 TSTFQRLFMISYLDDEILIVRDAAGAPEVLTRLDAPASP--MAEPTAEYES 311 >ref|XP_010265906.1| PREDICTED: probable plastid-lipid-associated protein 13, chloroplastic [Nelumbo nucifera] Length = 307 Score = 70.5 bits (171), Expect = 3e-09 Identities = 37/51 (72%), Positives = 39/51 (76%) Frame = -1 Query: 1308 SGTFQRLFMISYLDEEILIIRDAMGVPDVLTRLPAPLDPNDIIEPFAEYES 1156 SGTFQRLFMISYLDEEILIIRD G PDVLTRL P P I + +EYES Sbjct: 259 SGTFQRLFMISYLDEEILIIRDTTGAPDVLTRLEGP--PAPITDSISEYES 307 >ref|XP_008782852.1| PREDICTED: probable plastid-lipid-associated protein 13, chloroplastic isoform X2 [Phoenix dactylifera] Length = 300 Score = 70.1 bits (170), Expect = 4e-09 Identities = 39/54 (72%), Positives = 43/54 (79%), Gaps = 3/54 (5%) Frame = -1 Query: 1308 SGTFQRLFMISYLDEEILIIRDAMGVPDVLTRL---PAPLDPNDIIEPFAEYES 1156 SGTFQRLFMISYLDEEILIIRD+ G PDVLTRL PAPL + +I +EYES Sbjct: 250 SGTFQRLFMISYLDEEILIIRDSAGAPDVLTRLDGPPAPLPTDPVI---SEYES 300 >ref|XP_008782850.1| PREDICTED: probable plastid-lipid-associated protein 13, chloroplastic isoform X1 [Phoenix dactylifera] Length = 301 Score = 70.1 bits (170), Expect = 4e-09 Identities = 39/54 (72%), Positives = 43/54 (79%), Gaps = 3/54 (5%) Frame = -1 Query: 1308 SGTFQRLFMISYLDEEILIIRDAMGVPDVLTRL---PAPLDPNDIIEPFAEYES 1156 SGTFQRLFMISYLDEEILIIRD+ G PDVLTRL PAPL + +I +EYES Sbjct: 251 SGTFQRLFMISYLDEEILIIRDSAGAPDVLTRLDGPPAPLPTDPVI---SEYES 301 >ref|XP_002322666.2| hypothetical protein POPTR_0016s04520g [Populus trichocarpa] gi|118488681|gb|ABK96151.1| unknown [Populus trichocarpa] gi|550320821|gb|EEF04427.2| hypothetical protein POPTR_0016s04520g [Populus trichocarpa] Length = 311 Score = 68.9 bits (167), Expect = 9e-09 Identities = 35/51 (68%), Positives = 43/51 (84%) Frame = -1 Query: 1308 SGTFQRLFMISYLDEEILIIRDAMGVPDVLTRLPAPLDPNDIIEPFAEYES 1156 S TFQRLFMISYLD+EILI+RD++GVP+V+TRL AP + + EP AEYES Sbjct: 263 SSTFQRLFMISYLDDEILILRDSIGVPEVVTRLDAP--ASLMAEPIAEYES 311 >ref|XP_012087764.1| PREDICTED: probable plastid-lipid-associated protein 13, chloroplastic isoform X1 [Jatropha curcas] Length = 335 Score = 68.6 bits (166), Expect = 1e-08 Identities = 36/51 (70%), Positives = 40/51 (78%) Frame = -1 Query: 1308 SGTFQRLFMISYLDEEILIIRDAMGVPDVLTRLPAPLDPNDIIEPFAEYES 1156 +G+ QRLFMISYLDEEILIIRD GVP+VLTRL AP P + EP EYES Sbjct: 287 AGSLQRLFMISYLDEEILIIRDTAGVPEVLTRLDAPASP--MGEPSTEYES 335 >gb|KDP24623.1| hypothetical protein JCGZ_25539 [Jatropha curcas] Length = 307 Score = 68.6 bits (166), Expect = 1e-08 Identities = 36/51 (70%), Positives = 40/51 (78%) Frame = -1 Query: 1308 SGTFQRLFMISYLDEEILIIRDAMGVPDVLTRLPAPLDPNDIIEPFAEYES 1156 +G+ QRLFMISYLDEEILIIRD GVP+VLTRL AP P + EP EYES Sbjct: 259 AGSLQRLFMISYLDEEILIIRDTAGVPEVLTRLDAPASP--MGEPSTEYES 307 >ref|XP_012087765.1| PREDICTED: probable plastid-lipid-associated protein 13, chloroplastic isoform X2 [Jatropha curcas] Length = 334 Score = 68.2 bits (165), Expect = 2e-08 Identities = 36/50 (72%), Positives = 39/50 (78%) Frame = -1 Query: 1305 GTFQRLFMISYLDEEILIIRDAMGVPDVLTRLPAPLDPNDIIEPFAEYES 1156 G+ QRLFMISYLDEEILIIRD GVP+VLTRL AP P + EP EYES Sbjct: 287 GSLQRLFMISYLDEEILIIRDTAGVPEVLTRLDAPASP--MGEPSTEYES 334 >ref|XP_011033216.1| PREDICTED: probable plastid-lipid-associated protein 13, chloroplastic [Populus euphratica] Length = 309 Score = 68.2 bits (165), Expect = 2e-08 Identities = 35/51 (68%), Positives = 42/51 (82%) Frame = -1 Query: 1308 SGTFQRLFMISYLDEEILIIRDAMGVPDVLTRLPAPLDPNDIIEPFAEYES 1156 S TFQRLFMISYLD+EILI+RD+ GVP+V+TRL AP + + EP AEYES Sbjct: 261 SSTFQRLFMISYLDDEILILRDSTGVPEVVTRLEAP--ASLMAEPIAEYES 309 >ref|XP_004960206.1| PREDICTED: probable plastid-lipid-associated protein 13, chloroplastic [Setaria italica] gi|944248686|gb|KQL12949.1| hypothetical protein SETIT_022806mg [Setaria italica] Length = 298 Score = 67.4 bits (163), Expect = 3e-08 Identities = 39/55 (70%), Positives = 40/55 (72%), Gaps = 4/55 (7%) Frame = -1 Query: 1308 SGTFQRLFMISYLDEEILIIRDAMGVPDVLTRLPAPLDPNDI----IEPFAEYES 1156 SGTFQRLFMISYLDEEILIIRDA G PDVLTRL P PN I +EYES Sbjct: 245 SGTFQRLFMISYLDEEILIIRDAAGAPDVLTRLEGP-QPNPIDGTADAVISEYES 298 >ref|XP_003580768.1| PREDICTED: probable plastid-lipid-associated protein 13, chloroplastic [Brachypodium distachyon] gi|944049529|gb|KQJ85170.1| hypothetical protein BRADI_5g25350 [Brachypodium distachyon] Length = 298 Score = 67.0 bits (162), Expect = 4e-08 Identities = 36/55 (65%), Positives = 42/55 (76%), Gaps = 4/55 (7%) Frame = -1 Query: 1308 SGTFQRLFMISYLDEEILIIRDAMGVPDVLTRL----PAPLDPNDIIEPFAEYES 1156 +G FQRLFMISYLDEEILIIRDA G PDVLT+L P P+D +D + P EY+S Sbjct: 246 NGMFQRLFMISYLDEEILIIRDAAGAPDVLTKLEGPQPNPIDTSDTVIP--EYQS 298 >ref|XP_007028987.1| Plastid-lipid associated protein PAP / fibrillin family protein [Theobroma cacao] gi|508717592|gb|EOY09489.1| Plastid-lipid associated protein PAP / fibrillin family protein [Theobroma cacao] Length = 257 Score = 66.6 bits (161), Expect = 5e-08 Identities = 35/51 (68%), Positives = 40/51 (78%) Frame = -1 Query: 1308 SGTFQRLFMISYLDEEILIIRDAMGVPDVLTRLPAPLDPNDIIEPFAEYES 1156 SGTFQRLFMISYLDEEILIIRDA G+P+VLTRL P + + E +YES Sbjct: 209 SGTFQRLFMISYLDEEILIIRDAAGIPEVLTRLDPP--SSTMAETSPDYES 257 >gb|KMT15317.1| hypothetical protein BVRB_3g060230 isoform B [Beta vulgaris subsp. vulgaris] Length = 329 Score = 66.2 bits (160), Expect = 6e-08 Identities = 32/53 (60%), Positives = 40/53 (75%) Frame = -1 Query: 1314 TKSGTFQRLFMISYLDEEILIIRDAMGVPDVLTRLPAPLDPNDIIEPFAEYES 1156 T+ G+ QR+FMISYLDEEILIIRD+ G P++LTRL + P +EP EYES Sbjct: 279 TRGGSLQRMFMISYLDEEILIIRDSFGAPEILTRLDSASSPE--VEPSMEYES 329 >ref|XP_002530706.1| conserved hypothetical protein [Ricinus communis] gi|223529720|gb|EEF31660.1| conserved hypothetical protein [Ricinus communis] Length = 297 Score = 66.2 bits (160), Expect = 6e-08 Identities = 34/51 (66%), Positives = 39/51 (76%) Frame = -1 Query: 1308 SGTFQRLFMISYLDEEILIIRDAMGVPDVLTRLPAPLDPNDIIEPFAEYES 1156 SG+FQR+FMISYLDEEILIIRD G+P+VLTRL AP P + EYES Sbjct: 250 SGSFQRIFMISYLDEEILIIRDTAGIPEVLTRLEAPTSP---LVANGEYES 297