BLASTX nr result
ID: Papaver31_contig00031500
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00031500 (825 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011045192.1| PREDICTED: 54S ribosomal protein L37, mitoch... 171 8e-40 ref|XP_010033374.1| PREDICTED: 39S ribosomal protein L54, mitoch... 170 1e-39 ref|XP_002298595.1| hypothetical protein POPTR_0001s36310g [Popu... 170 1e-39 ref|XP_010271329.1| PREDICTED: 54S ribosomal protein L37, mitoch... 169 3e-39 ref|XP_012458699.1| PREDICTED: 54S ribosomal protein L37, mitoch... 168 4e-39 ref|XP_012458700.1| PREDICTED: 54S ribosomal protein L37, mitoch... 168 4e-39 ref|XP_006447155.1| hypothetical protein CICLE_v10017154mg [Citr... 168 5e-39 ref|XP_007031750.1| Mitochondrial ribosomal protein L37 isoform ... 167 8e-39 gb|KHG03339.1| 54S ribosomal L37, mitochondrial [Gossypium arbor... 164 7e-38 ref|XP_002265795.1| PREDICTED: 54S ribosomal protein L37, mitoch... 164 7e-38 gb|KJB74600.1| hypothetical protein B456_012G089400 [Gossypium r... 163 1e-37 ref|XP_002509570.1| conserved hypothetical protein [Ricinus comm... 162 2e-37 ref|XP_003620189.1| ribosomal protein L37 [Medicago truncatula] ... 162 2e-37 gb|AFK34152.1| unknown [Lotus japonicus] 162 4e-37 emb|CDP00969.1| unnamed protein product [Coffea canephora] 161 6e-37 gb|KJB70838.1| hypothetical protein B456_011G092800 [Gossypium r... 160 1e-36 ref|XP_012457195.1| PREDICTED: 39S ribosomal protein L54, mitoch... 160 1e-36 ref|XP_014507403.1| PREDICTED: 54S ribosomal protein L37, mitoch... 159 2e-36 ref|XP_007206136.1| hypothetical protein PRUPE_ppa013237mg [Prun... 159 2e-36 ref|NP_001238663.1| uncharacterized protein LOC100499962 [Glycin... 159 2e-36 >ref|XP_011045192.1| PREDICTED: 54S ribosomal protein L37, mitochondrial [Populus euphratica] gi|743903678|ref|XP_011045193.1| PREDICTED: 54S ribosomal protein L37, mitochondrial [Populus euphratica] Length = 131 Score = 171 bits (432), Expect = 8e-40 Identities = 89/132 (67%), Positives = 100/132 (75%) Frame = -1 Query: 618 MAMNCSRSLRSLILTKEAVGVVGRRTFXXXXXXXXXXXXXXXXXXXXASSLSKEIKSTTV 439 MAMNC +SLR +++TKEAVG+V RRTF SSL KE+KSTT Sbjct: 1 MAMNCIKSLRGIVITKEAVGMVDRRTFSAGAKKKGGKGGAAADAPKA-SSLGKEVKSTTT 59 Query: 438 VGGNILKEGTDPKLLADSEYPDWLGHLLDKKPALSELRRKNIETLPYDDLKRFVKLDNRA 259 VG NILK+GTDPK+L DSEYPDWL LLDK+PALSELRRKNIETLPY+DLKRFVKLDNRA Sbjct: 60 VGANILKDGTDPKVLDDSEYPDWLWRLLDKRPALSELRRKNIETLPYEDLKRFVKLDNRA 119 Query: 258 RIKENNSVKAKH 223 RIKENN KAK+ Sbjct: 120 RIKENNFSKAKN 131 >ref|XP_010033374.1| PREDICTED: 39S ribosomal protein L54, mitochondrial-like [Eucalyptus grandis] gi|702481840|ref|XP_010033375.1| PREDICTED: 39S ribosomal protein L54, mitochondrial-like [Eucalyptus grandis] gi|702481844|ref|XP_010033376.1| PREDICTED: 39S ribosomal protein L54, mitochondrial-like [Eucalyptus grandis] gi|629086637|gb|KCW52994.1| hypothetical protein EUGRSUZ_J02294 [Eucalyptus grandis] gi|629086638|gb|KCW52995.1| hypothetical protein EUGRSUZ_J02294 [Eucalyptus grandis] Length = 133 Score = 170 bits (431), Expect = 1e-39 Identities = 87/133 (65%), Positives = 101/133 (75%), Gaps = 1/133 (0%) Frame = -1 Query: 618 MAMNCSRSLRSLILTKEAVGVVGRRTFXXXXXXXXXXXXXXXXXXXXASS-LSKEIKSTT 442 MAMN RSL+ ++ KEA+G+VGRRTF +S LSKE+KSTT Sbjct: 1 MAMNHLRSLKGIVNVKEAIGIVGRRTFSAGGSKAKKGSKGGAAGDAAKASTLSKEVKSTT 60 Query: 441 VVGGNILKEGTDPKLLADSEYPDWLGHLLDKKPALSELRRKNIETLPYDDLKRFVKLDNR 262 VVG NILK+G DPK+L DSEYPDWL HL+DKKP LSELRRKN+ETLPY+DLKRFVKLDNR Sbjct: 61 VVGANILKDGADPKVLPDSEYPDWLCHLIDKKPPLSELRRKNVETLPYEDLKRFVKLDNR 120 Query: 261 ARIKENNSVKAKH 223 ARIKENNS+KAK+ Sbjct: 121 ARIKENNSIKAKN 133 >ref|XP_002298595.1| hypothetical protein POPTR_0001s36310g [Populus trichocarpa] gi|222845853|gb|EEE83400.1| hypothetical protein POPTR_0001s36310g [Populus trichocarpa] Length = 131 Score = 170 bits (430), Expect = 1e-39 Identities = 88/132 (66%), Positives = 100/132 (75%) Frame = -1 Query: 618 MAMNCSRSLRSLILTKEAVGVVGRRTFXXXXXXXXXXXXXXXXXXXXASSLSKEIKSTTV 439 MAMNC +SLR +++TKEAVG+V RRTF SSL KE+KSTT Sbjct: 1 MAMNCIKSLRGIVITKEAVGIVDRRTFSAGAKKKGGKGGAAADAPKA-SSLGKEVKSTTT 59 Query: 438 VGGNILKEGTDPKLLADSEYPDWLGHLLDKKPALSELRRKNIETLPYDDLKRFVKLDNRA 259 VG NILK+GTDPK+L DSEYPDWL LLDK+PALSELRRKNIETLP++DLKRFVKLDNRA Sbjct: 60 VGANILKDGTDPKVLDDSEYPDWLWRLLDKRPALSELRRKNIETLPFEDLKRFVKLDNRA 119 Query: 258 RIKENNSVKAKH 223 RIKENN KAK+ Sbjct: 120 RIKENNFSKAKN 131 >ref|XP_010271329.1| PREDICTED: 54S ribosomal protein L37, mitochondrial-like [Nelumbo nucifera] Length = 132 Score = 169 bits (427), Expect = 3e-39 Identities = 88/132 (66%), Positives = 99/132 (75%) Frame = -1 Query: 618 MAMNCSRSLRSLILTKEAVGVVGRRTFXXXXXXXXXXXXXXXXXXXXASSLSKEIKSTTV 439 MAM+C +S RS I++KEA VV RTF AS LSKE+KSTTV Sbjct: 1 MAMSCMKSFRSFIISKEAFRVVNCRTFSAAGGKAKKGSKGGAGDAPKASILSKEMKSTTV 60 Query: 438 VGGNILKEGTDPKLLADSEYPDWLGHLLDKKPALSELRRKNIETLPYDDLKRFVKLDNRA 259 VG NILK+G DPK+L DSEYPDWL HLLDKKPALSELRRKNIETLPYD+LKRFVKLDNRA Sbjct: 61 VGANILKDGADPKILPDSEYPDWLWHLLDKKPALSELRRKNIETLPYDELKRFVKLDNRA 120 Query: 258 RIKENNSVKAKH 223 RIKENN ++AK+ Sbjct: 121 RIKENNVIRAKN 132 >ref|XP_012458699.1| PREDICTED: 54S ribosomal protein L37, mitochondrial isoform X1 [Gossypium raimondii] gi|763807697|gb|KJB74599.1| hypothetical protein B456_012G089400 [Gossypium raimondii] Length = 144 Score = 168 bits (426), Expect = 4e-39 Identities = 88/132 (66%), Positives = 101/132 (76%) Frame = -1 Query: 618 MAMNCSRSLRSLILTKEAVGVVGRRTFXXXXXXXXXXXXXXXXXXXXASSLSKEIKSTTV 439 MA+N RSL+S+I+ K AVGV G+RTF S+LSKE+KSTTV Sbjct: 14 MALNQMRSLKSVIIAKNAVGV-GQRTFAAGAGKAKKGSKGAASDAPKGSTLSKEVKSTTV 72 Query: 438 VGGNILKEGTDPKLLADSEYPDWLGHLLDKKPALSELRRKNIETLPYDDLKRFVKLDNRA 259 VG NILK+G DPK+ DSEYPDWL HLLDK+PALSELRRK+IETLPY+DLKRFVKLDNRA Sbjct: 73 VGANILKDGADPKIFLDSEYPDWLWHLLDKRPALSELRRKDIETLPYEDLKRFVKLDNRA 132 Query: 258 RIKENNSVKAKH 223 RIKENNSVKAK+ Sbjct: 133 RIKENNSVKAKN 144 >ref|XP_012458700.1| PREDICTED: 54S ribosomal protein L37, mitochondrial isoform X2 [Gossypium raimondii] gi|763807696|gb|KJB74598.1| hypothetical protein B456_012G089400 [Gossypium raimondii] Length = 131 Score = 168 bits (426), Expect = 4e-39 Identities = 88/132 (66%), Positives = 101/132 (76%) Frame = -1 Query: 618 MAMNCSRSLRSLILTKEAVGVVGRRTFXXXXXXXXXXXXXXXXXXXXASSLSKEIKSTTV 439 MA+N RSL+S+I+ K AVGV G+RTF S+LSKE+KSTTV Sbjct: 1 MALNQMRSLKSVIIAKNAVGV-GQRTFAAGAGKAKKGSKGAASDAPKGSTLSKEVKSTTV 59 Query: 438 VGGNILKEGTDPKLLADSEYPDWLGHLLDKKPALSELRRKNIETLPYDDLKRFVKLDNRA 259 VG NILK+G DPK+ DSEYPDWL HLLDK+PALSELRRK+IETLPY+DLKRFVKLDNRA Sbjct: 60 VGANILKDGADPKIFLDSEYPDWLWHLLDKRPALSELRRKDIETLPYEDLKRFVKLDNRA 119 Query: 258 RIKENNSVKAKH 223 RIKENNSVKAK+ Sbjct: 120 RIKENNSVKAKN 131 >ref|XP_006447155.1| hypothetical protein CICLE_v10017154mg [Citrus clementina] gi|567909685|ref|XP_006447156.1| hypothetical protein CICLE_v10017154mg [Citrus clementina] gi|568831453|ref|XP_006469980.1| PREDICTED: 39S ribosomal protein L54, mitochondrial-like isoform X1 [Citrus sinensis] gi|568831457|ref|XP_006469981.1| PREDICTED: 39S ribosomal protein L54, mitochondrial-like isoform X2 [Citrus sinensis] gi|557549766|gb|ESR60395.1| hypothetical protein CICLE_v10017154mg [Citrus clementina] gi|557549767|gb|ESR60396.1| hypothetical protein CICLE_v10017154mg [Citrus clementina] gi|641821759|gb|KDO41387.1| hypothetical protein CISIN_1g032859mg [Citrus sinensis] Length = 132 Score = 168 bits (425), Expect = 5e-39 Identities = 88/132 (66%), Positives = 100/132 (75%) Frame = -1 Query: 618 MAMNCSRSLRSLILTKEAVGVVGRRTFXXXXXXXXXXXXXXXXXXXXASSLSKEIKSTTV 439 MAMN SLRS I+ KE VG VG+RTF AS LSKE+KSTTV Sbjct: 1 MAMNQITSLRSFIMVKETVGKVGQRTFAAGASKAKKGGKGAASDAPKASILSKEVKSTTV 60 Query: 438 VGGNILKEGTDPKLLADSEYPDWLGHLLDKKPALSELRRKNIETLPYDDLKRFVKLDNRA 259 VG NILKEG+DPK+L DSEYPDWL HLL+K+PALSEL+ KNIETLPY+DLKRF+KLDNRA Sbjct: 61 VGANILKEGSDPKVLPDSEYPDWLWHLLEKRPALSELKMKNIETLPYEDLKRFLKLDNRA 120 Query: 258 RIKENNSVKAKH 223 +IKENNSVKAK+ Sbjct: 121 KIKENNSVKAKN 132 >ref|XP_007031750.1| Mitochondrial ribosomal protein L37 isoform 1 [Theobroma cacao] gi|590646903|ref|XP_007031751.1| Mitochondrial ribosomal protein L37 isoform 1 [Theobroma cacao] gi|590646906|ref|XP_007031752.1| Mitochondrial ribosomal protein L37 isoform 1 [Theobroma cacao] gi|590646909|ref|XP_007031753.1| Mitochondrial ribosomal protein L37 isoform 1 [Theobroma cacao] gi|590646912|ref|XP_007031754.1| Mitochondrial ribosomal protein L37 isoform 1 [Theobroma cacao] gi|508710779|gb|EOY02676.1| Mitochondrial ribosomal protein L37 isoform 1 [Theobroma cacao] gi|508710780|gb|EOY02677.1| Mitochondrial ribosomal protein L37 isoform 1 [Theobroma cacao] gi|508710781|gb|EOY02678.1| Mitochondrial ribosomal protein L37 isoform 1 [Theobroma cacao] gi|508710782|gb|EOY02679.1| Mitochondrial ribosomal protein L37 isoform 1 [Theobroma cacao] gi|508710783|gb|EOY02680.1| Mitochondrial ribosomal protein L37 isoform 1 [Theobroma cacao] Length = 131 Score = 167 bits (423), Expect = 8e-39 Identities = 89/132 (67%), Positives = 100/132 (75%) Frame = -1 Query: 618 MAMNCSRSLRSLILTKEAVGVVGRRTFXXXXXXXXXXXXXXXXXXXXASSLSKEIKSTTV 439 MA+N RS+RS I+ KEAVGV G R F AS LSKE+KSTTV Sbjct: 1 MALNHIRSVRSFIIAKEAVGV-GHRRFAAGPGKAKKGSKGAASDAPKASILSKEVKSTTV 59 Query: 438 VGGNILKEGTDPKLLADSEYPDWLGHLLDKKPALSELRRKNIETLPYDDLKRFVKLDNRA 259 VG NILK+G DPK++ DSEYPDWL HLLDK+PALSELRRKNIETLPY+DLKRFVKLDNRA Sbjct: 60 VGANILKDGADPKIMPDSEYPDWLWHLLDKRPALSELRRKNIETLPYEDLKRFVKLDNRA 119 Query: 258 RIKENNSVKAKH 223 RIKENN+VKAK+ Sbjct: 120 RIKENNAVKAKN 131 >gb|KHG03339.1| 54S ribosomal L37, mitochondrial [Gossypium arboreum] Length = 131 Score = 164 bits (415), Expect = 7e-38 Identities = 87/132 (65%), Positives = 100/132 (75%) Frame = -1 Query: 618 MAMNCSRSLRSLILTKEAVGVVGRRTFXXXXXXXXXXXXXXXXXXXXASSLSKEIKSTTV 439 MA+ S S RS+I+ KEA+ G+RTF AS LSKE+KSTTV Sbjct: 1 MALTRSGSWRSVIVAKEAIAF-GQRTFAAAAGKSKKGSKGATSDAPKASVLSKEVKSTTV 59 Query: 438 VGGNILKEGTDPKLLADSEYPDWLGHLLDKKPALSELRRKNIETLPYDDLKRFVKLDNRA 259 VG NILK+GTDPK++ DSEYPDWL HLLDK+PALSELRRKNIETLPY+DLKRFVKLDNRA Sbjct: 60 VGANILKDGTDPKIMPDSEYPDWLWHLLDKRPALSELRRKNIETLPYEDLKRFVKLDNRA 119 Query: 258 RIKENNSVKAKH 223 RIKENNS+KAK+ Sbjct: 120 RIKENNSIKAKN 131 >ref|XP_002265795.1| PREDICTED: 54S ribosomal protein L37, mitochondrial [Vitis vinifera] gi|731418786|ref|XP_010660804.1| PREDICTED: 54S ribosomal protein L37, mitochondrial [Vitis vinifera] Length = 132 Score = 164 bits (415), Expect = 7e-38 Identities = 84/132 (63%), Positives = 102/132 (77%) Frame = -1 Query: 618 MAMNCSRSLRSLILTKEAVGVVGRRTFXXXXXXXXXXXXXXXXXXXXASSLSKEIKSTTV 439 M MN +S+RS+I+T+EAV +VG RTF AS+LSKE+KSTT Sbjct: 1 MTMNRIKSVRSIIITREAVRLVGCRTFAVGGKAKKGSKGGGASDAPKASTLSKEVKSTTT 60 Query: 438 VGGNILKEGTDPKLLADSEYPDWLGHLLDKKPALSELRRKNIETLPYDDLKRFVKLDNRA 259 VG NILK+GTDPK+L DSEYPDWL HLLDK+PALSELRRK++E+LPY+ LKRFVKLDNRA Sbjct: 61 VGANILKDGTDPKVLPDSEYPDWLWHLLDKRPALSELRRKSVESLPYEALKRFVKLDNRA 120 Query: 258 RIKENNSVKAKH 223 RIKENN++KAK+ Sbjct: 121 RIKENNNLKAKN 132 >gb|KJB74600.1| hypothetical protein B456_012G089400 [Gossypium raimondii] Length = 126 Score = 163 bits (413), Expect = 1e-37 Identities = 85/126 (67%), Positives = 97/126 (76%) Frame = -1 Query: 600 RSLRSLILTKEAVGVVGRRTFXXXXXXXXXXXXXXXXXXXXASSLSKEIKSTTVVGGNIL 421 RSL+S+I+ K AVGV G+RTF S+LSKE+KSTTVVG NIL Sbjct: 2 RSLKSVIIAKNAVGV-GQRTFAAGAGKAKKGSKGAASDAPKGSTLSKEVKSTTVVGANIL 60 Query: 420 KEGTDPKLLADSEYPDWLGHLLDKKPALSELRRKNIETLPYDDLKRFVKLDNRARIKENN 241 K+G DPK+ DSEYPDWL HLLDK+PALSELRRK+IETLPY+DLKRFVKLDNRARIKENN Sbjct: 61 KDGADPKIFLDSEYPDWLWHLLDKRPALSELRRKDIETLPYEDLKRFVKLDNRARIKENN 120 Query: 240 SVKAKH 223 SVKAK+ Sbjct: 121 SVKAKN 126 >ref|XP_002509570.1| conserved hypothetical protein [Ricinus communis] gi|223549469|gb|EEF50957.1| conserved hypothetical protein [Ricinus communis] Length = 130 Score = 162 bits (411), Expect = 2e-37 Identities = 83/132 (62%), Positives = 99/132 (75%) Frame = -1 Query: 618 MAMNCSRSLRSLILTKEAVGVVGRRTFXXXXXXXXXXXXXXXXXXXXASSLSKEIKSTTV 439 MAM+C +SLR +++TKEA+ +V +RTF +LSKE+KSTTV Sbjct: 1 MAMHCIKSLRGIVITKEAIRIVNQRTFATSKAKKGGKGGAAADAQK--ETLSKEVKSTTV 58 Query: 438 VGGNILKEGTDPKLLADSEYPDWLGHLLDKKPALSELRRKNIETLPYDDLKRFVKLDNRA 259 VG NILK+G DPK+L DS+YPDWL HLLDK+ LSELRRKNIETLPY+DLKRFVKLDNRA Sbjct: 59 VGANILKDGADPKILPDSDYPDWLWHLLDKRLPLSELRRKNIETLPYEDLKRFVKLDNRA 118 Query: 258 RIKENNSVKAKH 223 IKENNSVKAK+ Sbjct: 119 SIKENNSVKAKN 130 >ref|XP_003620189.1| ribosomal protein L37 [Medicago truncatula] gi|217069986|gb|ACJ83353.1| unknown [Medicago truncatula] gi|355495204|gb|AES76407.1| ribosomal protein L37 [Medicago truncatula] gi|388518995|gb|AFK47559.1| unknown [Medicago truncatula] Length = 131 Score = 162 bits (411), Expect = 2e-37 Identities = 87/133 (65%), Positives = 102/133 (76%), Gaps = 1/133 (0%) Frame = -1 Query: 618 MAMNCSRSLRSLIL-TKEAVGVVGRRTFXXXXXXXXXXXXXXXXXXXXASSLSKEIKSTT 442 MAMN RS+RS++ T EA+GV +RTF SSLSKE+K++T Sbjct: 1 MAMNHVRSVRSILSSTNEAIGVAYQRTFATGKAKKGKGGASADGPKE--SSLSKEVKAST 58 Query: 441 VVGGNILKEGTDPKLLADSEYPDWLGHLLDKKPALSELRRKNIETLPYDDLKRFVKLDNR 262 VVGGNILKEGTDPK+L DSEYPDWL HLLDK+PALSELRRK I+TLPY+DLKR+VKLDNR Sbjct: 59 VVGGNILKEGTDPKILPDSEYPDWLWHLLDKRPALSELRRKEIDTLPYEDLKRYVKLDNR 118 Query: 261 ARIKENNSVKAKH 223 ARIKENNS+KAK+ Sbjct: 119 ARIKENNSLKAKN 131 >gb|AFK34152.1| unknown [Lotus japonicus] Length = 131 Score = 162 bits (409), Expect = 4e-37 Identities = 86/132 (65%), Positives = 99/132 (75%) Frame = -1 Query: 618 MAMNCSRSLRSLILTKEAVGVVGRRTFXXXXXXXXXXXXXXXXXXXXASSLSKEIKSTTV 439 MAMN RS+R ++ TKEAVGV +R F SSLSKE+KS+TV Sbjct: 1 MAMNYVRSVRHVLTTKEAVGVASKRAFATGKAKKGSKGGGAGDGPKA-SSLSKEVKSSTV 59 Query: 438 VGGNILKEGTDPKLLADSEYPDWLGHLLDKKPALSELRRKNIETLPYDDLKRFVKLDNRA 259 VG NILKEG+DPK+L DSEYPDWL HLLDK+PALSELRRKNIETL Y+ LKR+VKLDNRA Sbjct: 60 VGANILKEGSDPKILPDSEYPDWLWHLLDKRPALSELRRKNIETLSYEYLKRYVKLDNRA 119 Query: 258 RIKENNSVKAKH 223 RIKENNS+KAK+ Sbjct: 120 RIKENNSLKAKN 131 >emb|CDP00969.1| unnamed protein product [Coffea canephora] Length = 131 Score = 161 bits (407), Expect = 6e-37 Identities = 84/132 (63%), Positives = 98/132 (74%) Frame = -1 Query: 618 MAMNCSRSLRSLILTKEAVGVVGRRTFXXXXXXXXXXXXXXXXXXXXASSLSKEIKSTTV 439 MA NC R+ RS + KE +GV G RTF S+LSKE+KSTTV Sbjct: 1 MAGNCLRAFRSAGVPKEVLGVGGCRTFSAGSGKAKKGSKGAADAPKE-STLSKEVKSTTV 59 Query: 438 VGGNILKEGTDPKLLADSEYPDWLGHLLDKKPALSELRRKNIETLPYDDLKRFVKLDNRA 259 VG NILK+G DPK+L DSEYP+WL HLLDK+PALSELRRK++ETLPY+DLKRFVKLDNRA Sbjct: 60 VGANILKDGADPKILPDSEYPEWLSHLLDKRPALSELRRKDLETLPYEDLKRFVKLDNRA 119 Query: 258 RIKENNSVKAKH 223 RIKENNS+KAK+ Sbjct: 120 RIKENNSIKAKN 131 >gb|KJB70838.1| hypothetical protein B456_011G092800 [Gossypium raimondii] Length = 147 Score = 160 bits (405), Expect = 1e-36 Identities = 85/132 (64%), Positives = 99/132 (75%) Frame = -1 Query: 618 MAMNCSRSLRSLILTKEAVGVVGRRTFXXXXXXXXXXXXXXXXXXXXASSLSKEIKSTTV 439 MA+ S S RS+I+ KEA+ G+RTF AS LSKE+KSTTV Sbjct: 17 MALTRSGSWRSVIVAKEAIAF-GQRTFAAAAGKSKKGSKGAASDAPKASILSKEVKSTTV 75 Query: 438 VGGNILKEGTDPKLLADSEYPDWLGHLLDKKPALSELRRKNIETLPYDDLKRFVKLDNRA 259 VG NILK+GTDPK++ DSEYPDW+ HLLDK+PALSELRRKNIETLPY+DLKRFVKLDNRA Sbjct: 76 VGANILKDGTDPKIMPDSEYPDWVWHLLDKRPALSELRRKNIETLPYEDLKRFVKLDNRA 135 Query: 258 RIKENNSVKAKH 223 IKENNS+KAK+ Sbjct: 136 LIKENNSIKAKN 147 >ref|XP_012457195.1| PREDICTED: 39S ribosomal protein L54, mitochondrial-like [Gossypium raimondii] gi|823249089|ref|XP_012457196.1| PREDICTED: 39S ribosomal protein L54, mitochondrial-like [Gossypium raimondii] gi|763803899|gb|KJB70837.1| hypothetical protein B456_011G092800 [Gossypium raimondii] gi|763803901|gb|KJB70839.1| hypothetical protein B456_011G092800 [Gossypium raimondii] Length = 131 Score = 160 bits (405), Expect = 1e-36 Identities = 85/132 (64%), Positives = 99/132 (75%) Frame = -1 Query: 618 MAMNCSRSLRSLILTKEAVGVVGRRTFXXXXXXXXXXXXXXXXXXXXASSLSKEIKSTTV 439 MA+ S S RS+I+ KEA+ G+RTF AS LSKE+KSTTV Sbjct: 1 MALTRSGSWRSVIVAKEAIAF-GQRTFAAAAGKSKKGSKGAASDAPKASILSKEVKSTTV 59 Query: 438 VGGNILKEGTDPKLLADSEYPDWLGHLLDKKPALSELRRKNIETLPYDDLKRFVKLDNRA 259 VG NILK+GTDPK++ DSEYPDW+ HLLDK+PALSELRRKNIETLPY+DLKRFVKLDNRA Sbjct: 60 VGANILKDGTDPKIMPDSEYPDWVWHLLDKRPALSELRRKNIETLPYEDLKRFVKLDNRA 119 Query: 258 RIKENNSVKAKH 223 IKENNS+KAK+ Sbjct: 120 LIKENNSIKAKN 131 >ref|XP_014507403.1| PREDICTED: 54S ribosomal protein L37, mitochondrial [Vigna radiata var. radiata] gi|951002674|ref|XP_014507404.1| PREDICTED: 54S ribosomal protein L37, mitochondrial [Vigna radiata var. radiata] Length = 131 Score = 159 bits (403), Expect = 2e-36 Identities = 84/132 (63%), Positives = 100/132 (75%) Frame = -1 Query: 618 MAMNCSRSLRSLILTKEAVGVVGRRTFXXXXXXXXXXXXXXXXXXXXASSLSKEIKSTTV 439 MAMN +RS+R ++ KEAV V +RT+ S+LSKE+K++TV Sbjct: 1 MAMNRARSIRYILTVKEAVKVAHQRTYAAGKAKKGSKGGGSADSPKA-STLSKEVKASTV 59 Query: 438 VGGNILKEGTDPKLLADSEYPDWLGHLLDKKPALSELRRKNIETLPYDDLKRFVKLDNRA 259 VG NILKEGTDPK+L DSEYPDWL HLLDK+PALSELRRKNIETL Y+DLKRFVKLDNRA Sbjct: 60 VGANILKEGTDPKILPDSEYPDWLWHLLDKRPALSELRRKNIETLSYEDLKRFVKLDNRA 119 Query: 258 RIKENNSVKAKH 223 RIKE+NS+KAK+ Sbjct: 120 RIKESNSLKAKN 131 >ref|XP_007206136.1| hypothetical protein PRUPE_ppa013237mg [Prunus persica] gi|462401778|gb|EMJ07335.1| hypothetical protein PRUPE_ppa013237mg [Prunus persica] Length = 133 Score = 159 bits (402), Expect = 2e-36 Identities = 84/133 (63%), Positives = 98/133 (73%), Gaps = 1/133 (0%) Frame = -1 Query: 618 MAMNCSRSLRSLILTKEAVGVVGRRTFXXXXXXXXXXXXXXXXXXXXASS-LSKEIKSTT 442 MAM+ ++ RS+I T EAVG+V RRTF +S L KE+KSTT Sbjct: 1 MAMSHVKTFRSIINTSEAVGIVSRRTFAIGGGKAKKGSKGAAQGDAPKASNLDKEVKSTT 60 Query: 441 VVGGNILKEGTDPKLLADSEYPDWLGHLLDKKPALSELRRKNIETLPYDDLKRFVKLDNR 262 VVG NILK+GTDPK+L D+EYPDWL LLDK+PALSEL RKNIETLPY DLKRFVKLDNR Sbjct: 61 VVGANILKDGTDPKILPDAEYPDWLWRLLDKRPALSELSRKNIETLPYKDLKRFVKLDNR 120 Query: 261 ARIKENNSVKAKH 223 ARIK+NNS+KAK+ Sbjct: 121 ARIKDNNSLKAKN 133 >ref|NP_001238663.1| uncharacterized protein LOC100499962 [Glycine max] gi|571552646|ref|XP_006603654.1| PREDICTED: uncharacterized protein LOC100499962 isoform X1 [Glycine max] gi|255628043|gb|ACU14366.1| unknown [Glycine max] gi|734402530|gb|KHN32063.1| hypothetical protein glysoja_044758 [Glycine soja] gi|947044706|gb|KRG94335.1| hypothetical protein GLYMA_19G077100 [Glycine max] Length = 131 Score = 159 bits (402), Expect = 2e-36 Identities = 84/132 (63%), Positives = 98/132 (74%) Frame = -1 Query: 618 MAMNCSRSLRSLILTKEAVGVVGRRTFXXXXXXXXXXXXXXXXXXXXASSLSKEIKSTTV 439 MAMN +R +R ++ TKE VGV +RTF S+LSKE+KS+TV Sbjct: 1 MAMNRARYIRHILTTKEVVGVACQRTFATGKAKKGSKGGAAADAPKA-STLSKEVKSSTV 59 Query: 438 VGGNILKEGTDPKLLADSEYPDWLGHLLDKKPALSELRRKNIETLPYDDLKRFVKLDNRA 259 VG NILKEGTDPK+ DSEYPDWL HLLDK+PALSELRR+NI+TL Y+DLKRFVKLD RA Sbjct: 60 VGANILKEGTDPKIQPDSEYPDWLWHLLDKRPALSELRRRNIDTLSYEDLKRFVKLDTRA 119 Query: 258 RIKENNSVKAKH 223 RIKENNSVKAK+ Sbjct: 120 RIKENNSVKAKN 131