BLASTX nr result
ID: Papaver31_contig00027323
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00027323 (593 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012087913.1| PREDICTED: probable anion transporter 3, chl... 86 1e-14 gb|KDP24491.1| hypothetical protein JCGZ_25055 [Jatropha curcas] 86 1e-14 ref|XP_012486196.1| PREDICTED: probable anion transporter 3, chl... 85 2e-14 ref|XP_012486197.1| PREDICTED: probable anion transporter 3, chl... 85 2e-14 ref|XP_002527859.1| Sialin, putative [Ricinus communis] gi|22353... 85 3e-14 gb|AJH76873.1| phosphate transporter [Manihot esculenta] 84 5e-14 emb|CDX93332.1| BnaC04g45640D [Brassica napus] 82 2e-13 ref|XP_010101818.1| putative anion transporter 3 [Morus notabili... 82 2e-13 ref|XP_011012355.1| PREDICTED: probable anion transporter 3, chl... 82 2e-13 gb|KDO42143.1| hypothetical protein CISIN_1g016338mg [Citrus sin... 82 3e-13 ref|XP_006429292.1| hypothetical protein CICLE_v10011514mg [Citr... 82 3e-13 ref|XP_002323555.2| hypothetical protein POPTR_0016s11850g [Popu... 82 3e-13 ref|XP_013634163.1| PREDICTED: probable anion transporter 3, chl... 81 4e-13 emb|CBI30430.3| unnamed protein product [Vitis vinifera] 81 4e-13 ref|XP_002273820.1| PREDICTED: probable anion transporter 3, chl... 81 4e-13 ref|XP_006411007.1| hypothetical protein EUTSA_v10017818mg [Eutr... 81 4e-13 emb|CAN65535.1| hypothetical protein VITISV_018284 [Vitis vinifera] 81 4e-13 ref|XP_012832108.1| PREDICTED: probable anion transporter 3, chl... 81 5e-13 ref|XP_009803867.1| PREDICTED: probable anion transporter 3, chl... 81 5e-13 ref|XP_009602210.1| PREDICTED: probable anion transporter 3, chl... 81 5e-13 >ref|XP_012087913.1| PREDICTED: probable anion transporter 3, chloroplastic [Jatropha curcas] Length = 499 Score = 86.3 bits (212), Expect = 1e-14 Identities = 42/50 (84%), Positives = 47/50 (94%) Frame = -1 Query: 311 EIWQSIGFIGPGVSLLCLNYAKTPAAASICLTAALSLSAFSQAGFLLNMQ 162 +I QSIGFIGPGVSLLCLNYAKTP AA++ +TAALSLS+FSQAGFLLNMQ Sbjct: 383 KIMQSIGFIGPGVSLLCLNYAKTPMAAAVLMTAALSLSSFSQAGFLLNMQ 432 >gb|KDP24491.1| hypothetical protein JCGZ_25055 [Jatropha curcas] Length = 447 Score = 86.3 bits (212), Expect = 1e-14 Identities = 42/50 (84%), Positives = 47/50 (94%) Frame = -1 Query: 311 EIWQSIGFIGPGVSLLCLNYAKTPAAASICLTAALSLSAFSQAGFLLNMQ 162 +I QSIGFIGPGVSLLCLNYAKTP AA++ +TAALSLS+FSQAGFLLNMQ Sbjct: 331 KIMQSIGFIGPGVSLLCLNYAKTPMAAAVLMTAALSLSSFSQAGFLLNMQ 380 >ref|XP_012486196.1| PREDICTED: probable anion transporter 3, chloroplastic isoform X1 [Gossypium raimondii] Length = 510 Score = 85.1 bits (209), Expect = 2e-14 Identities = 40/50 (80%), Positives = 47/50 (94%) Frame = -1 Query: 311 EIWQSIGFIGPGVSLLCLNYAKTPAAASICLTAALSLSAFSQAGFLLNMQ 162 +I QSIGFIGPGVSLLCLN+AK+P A++C+TAALSLS+FSQAGFLLNMQ Sbjct: 394 KIMQSIGFIGPGVSLLCLNFAKSPEMAAVCITAALSLSSFSQAGFLLNMQ 443 >ref|XP_012486197.1| PREDICTED: probable anion transporter 3, chloroplastic isoform X2 [Gossypium raimondii] gi|763769668|gb|KJB36883.1| hypothetical protein B456_006G180500 [Gossypium raimondii] Length = 506 Score = 85.1 bits (209), Expect = 2e-14 Identities = 40/50 (80%), Positives = 47/50 (94%) Frame = -1 Query: 311 EIWQSIGFIGPGVSLLCLNYAKTPAAASICLTAALSLSAFSQAGFLLNMQ 162 +I QSIGFIGPGVSLLCLN+AK+P A++C+TAALSLS+FSQAGFLLNMQ Sbjct: 390 KIMQSIGFIGPGVSLLCLNFAKSPEMAAVCITAALSLSSFSQAGFLLNMQ 439 >ref|XP_002527859.1| Sialin, putative [Ricinus communis] gi|223532710|gb|EEF34490.1| Sialin, putative [Ricinus communis] Length = 501 Score = 84.7 bits (208), Expect = 3e-14 Identities = 41/50 (82%), Positives = 46/50 (92%) Frame = -1 Query: 311 EIWQSIGFIGPGVSLLCLNYAKTPAAASICLTAALSLSAFSQAGFLLNMQ 162 ++ QSIGFIGPGVSLLCLNYAKTP A+I +TAALSLS+FSQAGFLLNMQ Sbjct: 385 KVMQSIGFIGPGVSLLCLNYAKTPVTAAIFITAALSLSSFSQAGFLLNMQ 434 >gb|AJH76873.1| phosphate transporter [Manihot esculenta] Length = 505 Score = 84.0 bits (206), Expect = 5e-14 Identities = 41/50 (82%), Positives = 46/50 (92%) Frame = -1 Query: 311 EIWQSIGFIGPGVSLLCLNYAKTPAAASICLTAALSLSAFSQAGFLLNMQ 162 +I QSIGFIGPGVSLLCLN+AKTP AS+ +TAALSLS+FSQAGFLLNMQ Sbjct: 389 KIMQSIGFIGPGVSLLCLNFAKTPVTASMLITAALSLSSFSQAGFLLNMQ 438 >emb|CDX93332.1| BnaC04g45640D [Brassica napus] Length = 513 Score = 82.4 bits (202), Expect = 2e-13 Identities = 40/57 (70%), Positives = 49/57 (85%) Frame = -1 Query: 311 EIWQSIGFIGPGVSLLCLNYAKTPAAASICLTAALSLSAFSQAGFLLNMQVNTRRKY 141 +I QSIGFIGPG+SLLCLNYAK+P+ A+I +T ALSLS+FSQAGFLLNMQ + +Y Sbjct: 396 KIMQSIGFIGPGLSLLCLNYAKSPSCAAILMTIALSLSSFSQAGFLLNMQQDIAPEY 452 >ref|XP_010101818.1| putative anion transporter 3 [Morus notabilis] gi|587901691|gb|EXB89955.1| putative anion transporter 3 [Morus notabilis] Length = 519 Score = 82.0 bits (201), Expect = 2e-13 Identities = 39/50 (78%), Positives = 45/50 (90%) Frame = -1 Query: 311 EIWQSIGFIGPGVSLLCLNYAKTPAAASICLTAALSLSAFSQAGFLLNMQ 162 +I QSIGFIGPGV+LLCLNYAKTP A++ +T ALSLS+FSQAGFLLNMQ Sbjct: 401 KIMQSIGFIGPGVALLCLNYAKTPVVAAVLMTIALSLSSFSQAGFLLNMQ 450 >ref|XP_011012355.1| PREDICTED: probable anion transporter 3, chloroplastic [Populus euphratica] Length = 513 Score = 82.0 bits (201), Expect = 2e-13 Identities = 40/50 (80%), Positives = 44/50 (88%) Frame = -1 Query: 311 EIWQSIGFIGPGVSLLCLNYAKTPAAASICLTAALSLSAFSQAGFLLNMQ 162 +I QSIGFIGPGVSLLCLNYAKTP A+ +T ALSLS+FSQAGFLLNMQ Sbjct: 397 KIMQSIGFIGPGVSLLCLNYAKTPVTAAALMTVALSLSSFSQAGFLLNMQ 446 >gb|KDO42143.1| hypothetical protein CISIN_1g016338mg [Citrus sinensis] Length = 339 Score = 81.6 bits (200), Expect = 3e-13 Identities = 38/51 (74%), Positives = 47/51 (92%) Frame = -1 Query: 311 EIWQSIGFIGPGVSLLCLNYAKTPAAASICLTAALSLSAFSQAGFLLNMQV 159 +I QSIGFIGPGVSLLCLNYAK+PA A++ +T ALSLS+FSQAG+LLN+Q+ Sbjct: 275 KIMQSIGFIGPGVSLLCLNYAKSPAVAAVLITIALSLSSFSQAGYLLNIQI 325 >ref|XP_006429292.1| hypothetical protein CICLE_v10011514mg [Citrus clementina] gi|557531349|gb|ESR42532.1| hypothetical protein CICLE_v10011514mg [Citrus clementina] Length = 460 Score = 81.6 bits (200), Expect = 3e-13 Identities = 38/51 (74%), Positives = 47/51 (92%) Frame = -1 Query: 311 EIWQSIGFIGPGVSLLCLNYAKTPAAASICLTAALSLSAFSQAGFLLNMQV 159 +I QSIGFIGPGVSLLCLNYAK+PA A++ +T ALSLS+FSQAG+LLN+Q+ Sbjct: 396 KIMQSIGFIGPGVSLLCLNYAKSPAVAAVLITIALSLSSFSQAGYLLNIQI 446 >ref|XP_002323555.2| hypothetical protein POPTR_0016s11850g [Populus trichocarpa] gi|550321303|gb|EEF05316.2| hypothetical protein POPTR_0016s11850g [Populus trichocarpa] Length = 343 Score = 81.6 bits (200), Expect = 3e-13 Identities = 40/50 (80%), Positives = 44/50 (88%) Frame = -1 Query: 311 EIWQSIGFIGPGVSLLCLNYAKTPAAASICLTAALSLSAFSQAGFLLNMQ 162 +I QSIGFIGPGVSLLCLNYAKTP A+ +T ALSLS+FSQAGFLLNMQ Sbjct: 227 KIMQSIGFIGPGVSLLCLNYAKTPVTAAALMTIALSLSSFSQAGFLLNMQ 276 >ref|XP_013634163.1| PREDICTED: probable anion transporter 3, chloroplastic [Brassica oleracea var. oleracea] gi|923840392|ref|XP_013700716.1| PREDICTED: probable anion transporter 3, chloroplastic [Brassica napus] Length = 515 Score = 81.3 bits (199), Expect = 4e-13 Identities = 39/50 (78%), Positives = 46/50 (92%) Frame = -1 Query: 311 EIWQSIGFIGPGVSLLCLNYAKTPAAASICLTAALSLSAFSQAGFLLNMQ 162 +I QSIGFIGPG+SLLCLNYAK+P+ A+I +T ALSLS+FSQAGFLLNMQ Sbjct: 399 KIMQSIGFIGPGLSLLCLNYAKSPSCAAILMTIALSLSSFSQAGFLLNMQ 448 >emb|CBI30430.3| unnamed protein product [Vitis vinifera] Length = 405 Score = 81.3 bits (199), Expect = 4e-13 Identities = 40/50 (80%), Positives = 45/50 (90%) Frame = -1 Query: 311 EIWQSIGFIGPGVSLLCLNYAKTPAAASICLTAALSLSAFSQAGFLLNMQ 162 +I QSIGFIGPGVSLLCLN+AKTP A++ LTA LSLS+FSQAGFLLNMQ Sbjct: 288 KIMQSIGFIGPGVSLLCLNHAKTPVTAAMFLTAGLSLSSFSQAGFLLNMQ 337 >ref|XP_002273820.1| PREDICTED: probable anion transporter 3, chloroplastic [Vitis vinifera] Length = 507 Score = 81.3 bits (199), Expect = 4e-13 Identities = 40/50 (80%), Positives = 45/50 (90%) Frame = -1 Query: 311 EIWQSIGFIGPGVSLLCLNYAKTPAAASICLTAALSLSAFSQAGFLLNMQ 162 +I QSIGFIGPGVSLLCLN+AKTP A++ LTA LSLS+FSQAGFLLNMQ Sbjct: 390 KIMQSIGFIGPGVSLLCLNHAKTPVTAAMFLTAGLSLSSFSQAGFLLNMQ 439 >ref|XP_006411007.1| hypothetical protein EUTSA_v10017818mg [Eutrema salsugineum] gi|557112176|gb|ESQ52460.1| hypothetical protein EUTSA_v10017818mg [Eutrema salsugineum] Length = 529 Score = 81.3 bits (199), Expect = 4e-13 Identities = 39/50 (78%), Positives = 46/50 (92%) Frame = -1 Query: 311 EIWQSIGFIGPGVSLLCLNYAKTPAAASICLTAALSLSAFSQAGFLLNMQ 162 +I QSIGF+GPG+SLLCLNYAKTP+ A+I +T ALSLS+FSQAGFLLNMQ Sbjct: 413 KIMQSIGFMGPGLSLLCLNYAKTPSCAAIFMTIALSLSSFSQAGFLLNMQ 462 >emb|CAN65535.1| hypothetical protein VITISV_018284 [Vitis vinifera] Length = 507 Score = 81.3 bits (199), Expect = 4e-13 Identities = 40/50 (80%), Positives = 45/50 (90%) Frame = -1 Query: 311 EIWQSIGFIGPGVSLLCLNYAKTPAAASICLTAALSLSAFSQAGFLLNMQ 162 +I QSIGFIGPGVSLLCLN+AKTP A++ LTA LSLS+FSQAGFLLNMQ Sbjct: 402 KIMQSIGFIGPGVSLLCLNHAKTPVTAAMFLTAGLSLSSFSQAGFLLNMQ 451 >ref|XP_012832108.1| PREDICTED: probable anion transporter 3, chloroplastic [Erythranthe guttatus] Length = 522 Score = 80.9 bits (198), Expect = 5e-13 Identities = 39/50 (78%), Positives = 44/50 (88%) Frame = -1 Query: 311 EIWQSIGFIGPGVSLLCLNYAKTPAAASICLTAALSLSAFSQAGFLLNMQ 162 +I QSIGFIGPGV+LLCLNY KTP A++ LT ALSLS+FSQAGFLLNMQ Sbjct: 406 KIMQSIGFIGPGVALLCLNYVKTPTVAAVFLTIALSLSSFSQAGFLLNMQ 455 >ref|XP_009803867.1| PREDICTED: probable anion transporter 3, chloroplastic [Nicotiana sylvestris] Length = 514 Score = 80.9 bits (198), Expect = 5e-13 Identities = 38/50 (76%), Positives = 44/50 (88%) Frame = -1 Query: 311 EIWQSIGFIGPGVSLLCLNYAKTPAAASICLTAALSLSAFSQAGFLLNMQ 162 ++ QSIGFIGPGVSLLCLNYAKTP A++ +T ALS S+FSQAGFLLNMQ Sbjct: 398 KVMQSIGFIGPGVSLLCLNYAKTPEVAAVMITIALSFSSFSQAGFLLNMQ 447 >ref|XP_009602210.1| PREDICTED: probable anion transporter 3, chloroplastic [Nicotiana tomentosiformis] Length = 514 Score = 80.9 bits (198), Expect = 5e-13 Identities = 38/50 (76%), Positives = 44/50 (88%) Frame = -1 Query: 311 EIWQSIGFIGPGVSLLCLNYAKTPAAASICLTAALSLSAFSQAGFLLNMQ 162 ++ QSIGFIGPGVSLLCLNYAKTP A++ +T ALS S+FSQAGFLLNMQ Sbjct: 398 KVMQSIGFIGPGVSLLCLNYAKTPEVAAVMITIALSFSSFSQAGFLLNMQ 447