BLASTX nr result
ID: Papaver31_contig00027171
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00027171 (924 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001275073.1| 3'-5'-exoribonuclease/RNA binding protein-li... 45 4e-09 ref|XP_010269779.1| PREDICTED: exosome complex component RRP43 i... 50 2e-08 ref|XP_010064525.1| PREDICTED: exosome complex component RRP43-l... 47 7e-08 gb|KCW87868.1| hypothetical protein EUGRSUZ_A00263 [Eucalyptus g... 47 7e-08 gb|KMT15029.1| hypothetical protein BVRB_3g061540 [Beta vulgaris... 49 2e-07 ref|XP_006381009.1| hypothetical protein POPTR_0006s04970g [Popu... 47 2e-07 ref|XP_012086156.1| PREDICTED: exosome complex component RRP43 i... 47 2e-07 ref|XP_011048048.1| PREDICTED: exosome complex component RRP43-l... 47 2e-07 ref|XP_010043326.1| PREDICTED: exosome complex component RRP43 [... 47 2e-07 ref|XP_012086159.1| PREDICTED: exosome complex component RRP43 i... 47 2e-07 ref|XP_002532079.1| exosome complex exonuclease rrp43, putative ... 47 3e-07 gb|KNA17234.1| hypothetical protein SOVF_082010 [Spinacia oleracea] 44 1e-06 ref|XP_010063946.1| PREDICTED: exosome complex component RRP43-l... 42 6e-06 >ref|NP_001275073.1| 3'-5'-exoribonuclease/RNA binding protein-like protein [Solanum tuberosum] gi|83283957|gb|ABC01886.1| 3'-5'-exoribonuclease/RNA binding protein-like protein [Solanum tuberosum] Length = 314 Score = 45.4 bits (106), Expect(2) = 4e-09 Identities = 21/40 (52%), Positives = 29/40 (72%) Frame = -3 Query: 223 TLTYSG*PFLTSSSVVQGCVGLAKDREKELHQILNEAISE 104 +L G P L+ +SV+Q C+GLA+ R KEL +LNEAIS+ Sbjct: 260 SLNKPGGPVLSHTSVIQDCIGLARRRAKELQSVLNEAISD 299 Score = 43.9 bits (102), Expect(2) = 4e-09 Identities = 20/48 (41%), Positives = 32/48 (66%) Frame = -1 Query: 372 ISVFPMNDEGKVIALSIGNKRNKTVHDPLDKERRKLTLNFVPFSLTYV 229 I V +ND+G+++ +S R K +P++ E+RKL LN +PFSLT + Sbjct: 179 IPVVSLNDDGRIVLVSEDTVRLKLEKEPVNTEKRKLKLNSLPFSLTCI 226 >ref|XP_010269779.1| PREDICTED: exosome complex component RRP43 isoform X1 [Nelumbo nucifera] gi|720044114|ref|XP_010269780.1| PREDICTED: exosome complex component RRP43 isoform X1 [Nelumbo nucifera] Length = 303 Score = 50.4 bits (119), Expect(2) = 2e-08 Identities = 22/48 (45%), Positives = 34/48 (70%) Frame = -1 Query: 372 ISVFPMNDEGKVIALSIGNKRNKTVHDPLDKERRKLTLNFVPFSLTYV 229 I +ND+G+V+ +S N+ K + DP++KE+RKLTL +PFSLT + Sbjct: 179 IPAVTVNDDGRVVIMSGENEEGKLLKDPVNKEKRKLTLTCIPFSLTCI 226 Score = 36.6 bits (83), Expect(2) = 2e-08 Identities = 18/35 (51%), Positives = 23/35 (65%) Frame = -3 Query: 208 G*PFLTSSSVVQGCVGLAKDREKELHQILNEAISE 104 G P L S VQ CV L + R KEL +IL++AIS+ Sbjct: 265 GGPVLAYMSAVQDCVALTRQRVKELQKILSDAISD 299 >ref|XP_010064525.1| PREDICTED: exosome complex component RRP43-like [Eucalyptus grandis] Length = 205 Score = 46.6 bits (109), Expect(2) = 7e-08 Identities = 22/48 (45%), Positives = 33/48 (68%) Frame = -1 Query: 372 ISVFPMNDEGKVIALSIGNKRNKTVHDPLDKERRKLTLNFVPFSLTYV 229 I V +NDEG+++ +S + K +P+DKERRKL+L +PFSLT + Sbjct: 81 IPVVSLNDEGRMVMVSKELEGEKLDKEPVDKERRKLSLKSIPFSLTCI 128 Score = 38.5 bits (88), Expect(2) = 7e-08 Identities = 18/34 (52%), Positives = 24/34 (70%) Frame = -3 Query: 208 G*PFLTSSSVVQGCVGLAKDREKELHQILNEAIS 107 G P L +SV+Q CV L + R KEL +I++EAIS Sbjct: 167 GGPVLAHTSVIQECVALTRQRMKELEEIIDEAIS 200 >gb|KCW87868.1| hypothetical protein EUGRSUZ_A00263 [Eucalyptus grandis] Length = 172 Score = 46.6 bits (109), Expect(2) = 7e-08 Identities = 22/48 (45%), Positives = 33/48 (68%) Frame = -1 Query: 372 ISVFPMNDEGKVIALSIGNKRNKTVHDPLDKERRKLTLNFVPFSLTYV 229 I V +NDEG+++ +S + K +P+DKERRKL+L +PFSLT + Sbjct: 48 IPVVSLNDEGRMVMVSKELEGEKLDKEPVDKERRKLSLKSIPFSLTCI 95 Score = 38.5 bits (88), Expect(2) = 7e-08 Identities = 18/34 (52%), Positives = 24/34 (70%) Frame = -3 Query: 208 G*PFLTSSSVVQGCVGLAKDREKELHQILNEAIS 107 G P L +SV+Q CV L + R KEL +I++EAIS Sbjct: 134 GGPVLAHTSVIQECVALTRQRMKELEEIIDEAIS 167 >gb|KMT15029.1| hypothetical protein BVRB_3g061540 [Beta vulgaris subsp. vulgaris] Length = 307 Score = 49.3 bits (116), Expect(2) = 2e-07 Identities = 24/48 (50%), Positives = 34/48 (70%) Frame = -1 Query: 372 ISVFPMNDEGKVIALSIGNKRNKTVHDPLDKERRKLTLNFVPFSLTYV 229 I V +NDEG+V +S + K+ +P++KERRKLTL+ +PFSLT V Sbjct: 183 IPVVSLNDEGRVFIVSEEEEEGKSRKEPVNKERRKLTLSNIPFSLTCV 230 Score = 34.7 bits (78), Expect(2) = 2e-07 Identities = 16/35 (45%), Positives = 23/35 (65%) Frame = -3 Query: 208 G*PFLTSSSVVQGCVGLAKDREKELHQILNEAISE 104 G P + +SV+Q CV L + R +EL IL EAI++ Sbjct: 269 GGPVMAYTSVIQDCVALTRQRVQELQLILKEAIAD 303 >ref|XP_006381009.1| hypothetical protein POPTR_0006s04970g [Populus trichocarpa] gi|550335486|gb|ERP58806.1| hypothetical protein POPTR_0006s04970g [Populus trichocarpa] Length = 303 Score = 47.4 bits (111), Expect(2) = 2e-07 Identities = 20/48 (41%), Positives = 34/48 (70%) Frame = -1 Query: 372 ISVFPMNDEGKVIALSIGNKRNKTVHDPLDKERRKLTLNFVPFSLTYV 229 I + +ND+GK++ +S + K +P++KE+RKLTL+ +PFSLT + Sbjct: 179 IPIVSLNDDGKIVLVSEEDDGTKLEEEPVNKEKRKLTLSSIPFSLTCI 226 Score = 36.6 bits (83), Expect(2) = 2e-07 Identities = 18/34 (52%), Positives = 21/34 (61%) Frame = -3 Query: 208 G*PFLTSSSVVQGCVGLAKDREKELHQILNEAIS 107 G P L +S VQ CV L + R KEL IL+E IS Sbjct: 265 GGPVLAQTSAVQDCVALTRQRVKELQDILDETIS 298 >ref|XP_012086156.1| PREDICTED: exosome complex component RRP43 isoform X1 [Jatropha curcas] gi|802728313|ref|XP_012086157.1| PREDICTED: exosome complex component RRP43 isoform X1 [Jatropha curcas] gi|802728316|ref|XP_012086158.1| PREDICTED: exosome complex component RRP43 isoform X1 [Jatropha curcas] gi|643713066|gb|KDP26052.1| hypothetical protein JCGZ_21085 [Jatropha curcas] Length = 305 Score = 47.0 bits (110), Expect(2) = 2e-07 Identities = 19/48 (39%), Positives = 36/48 (75%) Frame = -1 Query: 372 ISVFPMNDEGKVIALSIGNKRNKTVHDPLDKERRKLTLNFVPFSLTYV 229 I + +ND+GK++ LS ++ ++ P+++E+RKLTL+ +PFSLT++ Sbjct: 179 IPIVSLNDDGKIVVLSEEDEIGRSEKKPVNQEKRKLTLSSLPFSLTFI 226 Score = 36.6 bits (83), Expect(2) = 2e-07 Identities = 19/34 (55%), Positives = 22/34 (64%) Frame = -3 Query: 208 G*PFLTSSSVVQGCVGLAKDREKELHQILNEAIS 107 G P L +S VQ CV L + R KEL IL+EAIS Sbjct: 265 GGPVLAYTSAVQDCVALTRQRVKELQGILDEAIS 298 >ref|XP_011048048.1| PREDICTED: exosome complex component RRP43-like [Populus euphratica] gi|743909153|ref|XP_011048049.1| PREDICTED: exosome complex component RRP43-like [Populus euphratica] Length = 303 Score = 47.0 bits (110), Expect(2) = 2e-07 Identities = 20/48 (41%), Positives = 34/48 (70%) Frame = -1 Query: 372 ISVFPMNDEGKVIALSIGNKRNKTVHDPLDKERRKLTLNFVPFSLTYV 229 I + +ND+GK++ +S + K +P++KE+RKLTL+ +PFSLT + Sbjct: 179 IPIVSLNDDGKIVLVSEEDDGTKLEDEPVNKEKRKLTLSSIPFSLTCI 226 Score = 36.6 bits (83), Expect(2) = 2e-07 Identities = 18/34 (52%), Positives = 21/34 (61%) Frame = -3 Query: 208 G*PFLTSSSVVQGCVGLAKDREKELHQILNEAIS 107 G P L +S VQ CV L + R KEL IL+E IS Sbjct: 265 GGPVLAQTSAVQDCVALTRQRVKELQDILDETIS 298 >ref|XP_010043326.1| PREDICTED: exosome complex component RRP43 [Eucalyptus grandis] gi|629123253|gb|KCW87678.1| hypothetical protein EUGRSUZ_A00059 [Eucalyptus grandis] Length = 303 Score = 46.6 bits (109), Expect(2) = 2e-07 Identities = 22/48 (45%), Positives = 33/48 (68%) Frame = -1 Query: 372 ISVFPMNDEGKVIALSIGNKRNKTVHDPLDKERRKLTLNFVPFSLTYV 229 I V +NDEG+++ +S + K +P+DKERRKL+L +PFSLT + Sbjct: 179 IPVVSLNDEGRMVMVSKELEGEKLDKEPVDKERRKLSLKSIPFSLTCI 226 Score = 37.0 bits (84), Expect(2) = 2e-07 Identities = 17/34 (50%), Positives = 23/34 (67%) Frame = -3 Query: 208 G*PFLTSSSVVQGCVGLAKDREKELHQILNEAIS 107 G P L +S +Q CV L + R KEL +I++EAIS Sbjct: 265 GGPVLAHTSAIQECVALTRQRMKELEEIIDEAIS 298 >ref|XP_012086159.1| PREDICTED: exosome complex component RRP43 isoform X2 [Jatropha curcas] Length = 250 Score = 47.0 bits (110), Expect(2) = 2e-07 Identities = 19/48 (39%), Positives = 36/48 (75%) Frame = -1 Query: 372 ISVFPMNDEGKVIALSIGNKRNKTVHDPLDKERRKLTLNFVPFSLTYV 229 I + +ND+GK++ LS ++ ++ P+++E+RKLTL+ +PFSLT++ Sbjct: 124 IPIVSLNDDGKIVVLSEEDEIGRSEKKPVNQEKRKLTLSSLPFSLTFI 171 Score = 36.6 bits (83), Expect(2) = 2e-07 Identities = 19/34 (55%), Positives = 22/34 (64%) Frame = -3 Query: 208 G*PFLTSSSVVQGCVGLAKDREKELHQILNEAIS 107 G P L +S VQ CV L + R KEL IL+EAIS Sbjct: 210 GGPVLAYTSAVQDCVALTRQRVKELQGILDEAIS 243 >ref|XP_002532079.1| exosome complex exonuclease rrp43, putative [Ricinus communis] gi|223528261|gb|EEF30313.1| exosome complex exonuclease rrp43, putative [Ricinus communis] Length = 303 Score = 46.6 bits (109), Expect(2) = 3e-07 Identities = 22/48 (45%), Positives = 33/48 (68%) Frame = -1 Query: 372 ISVFPMNDEGKVIALSIGNKRNKTVHDPLDKERRKLTLNFVPFSLTYV 229 I + +ND+GKV+ +S N+ K + ++KE+RKLTL +PFSLT V Sbjct: 179 IPIVSLNDDGKVVVVSDENEGGKREKEAVNKEKRKLTLRSLPFSLTCV 226 Score = 36.6 bits (83), Expect(2) = 3e-07 Identities = 18/34 (52%), Positives = 22/34 (64%) Frame = -3 Query: 208 G*PFLTSSSVVQGCVGLAKDREKELHQILNEAIS 107 G P L +S VQ CV L + R KEL IL+EA+S Sbjct: 265 GGPVLAYTSAVQDCVALTRQRVKELQNILDEALS 298 >gb|KNA17234.1| hypothetical protein SOVF_082010 [Spinacia oleracea] Length = 302 Score = 43.9 bits (102), Expect(2) = 1e-06 Identities = 23/48 (47%), Positives = 34/48 (70%) Frame = -1 Query: 372 ISVFPMNDEGKVIALSIGNKRNKTVHDPLDKERRKLTLNFVPFSLTYV 229 I V +NDEG+V +S + K+ +P++KE+RKLTL+ +PFSLT V Sbjct: 179 IPVVSLNDEGRVF-ISEEMEEGKSKREPVNKEQRKLTLSNIPFSLTCV 225 Score = 37.0 bits (84), Expect(2) = 1e-06 Identities = 18/35 (51%), Positives = 23/35 (65%) Frame = -3 Query: 208 G*PFLTSSSVVQGCVGLAKDREKELHQILNEAISE 104 G P L ++ +Q CV L K R +EL ILNEAIS+ Sbjct: 264 GGPVLAYTAAIQDCVALTKQRVQELQIILNEAISD 298 >ref|XP_010063946.1| PREDICTED: exosome complex component RRP43-like [Eucalyptus grandis] Length = 208 Score = 41.6 bits (96), Expect(2) = 6e-06 Identities = 19/40 (47%), Positives = 28/40 (70%) Frame = -1 Query: 357 MNDEGKVIALSIGNKRNKTVHDPLDKERRKLTLNFVPFSL 238 +NDEG+++ +S + K +P+DKERRKL L +PFSL Sbjct: 90 LNDEGRMVMVSEELEGEKLDKEPVDKERRKLLLKSIPFSL 129 Score = 37.0 bits (84), Expect(2) = 6e-06 Identities = 17/34 (50%), Positives = 23/34 (67%) Frame = -3 Query: 208 G*PFLTSSSVVQGCVGLAKDREKELHQILNEAIS 107 G P L +S +Q CV L + R KEL +I++EAIS Sbjct: 170 GGPVLAHTSAIQECVALTRQRMKELQEIIDEAIS 203