BLASTX nr result
ID: Papaver31_contig00027127
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00027127 (477 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB44081.1| hypothetical protein B456_007G233400 [Gossypium r... 67 7e-09 >gb|KJB44081.1| hypothetical protein B456_007G233400 [Gossypium raimondii] Length = 356 Score = 66.6 bits (161), Expect = 7e-09 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = +3 Query: 351 MSQRPNIPHSSTVAFGLHSHLLVSSEMNPNSN 446 MSQRPN+PHSS++AFGLHSHLLVSSEMNPNSN Sbjct: 1 MSQRPNVPHSSSIAFGLHSHLLVSSEMNPNSN 32