BLASTX nr result
ID: Papaver31_contig00027114
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00027114 (407 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHN77916.1| hypothetical protein Tcan_18365 [Toxocara canis] 56 9e-06 >gb|KHN77916.1| hypothetical protein Tcan_18365 [Toxocara canis] Length = 137 Score = 56.2 bits (134), Expect = 9e-06 Identities = 23/68 (33%), Positives = 35/68 (51%) Frame = -1 Query: 209 ACWT*EVHGQENWTLRVLNVNQQASWTLQVPSVNEQASWMLQVPSVNEQASWTLQVPSVN 30 A T +GQ W ++ N N Q W +Q+ + NEQ W +Q + N Q +Q+ + N Sbjct: 11 AMQTTNANGQCKWAMQTSNANVQCKWAMQMGNANEQCKWAMQTSNANGQCKRAMQMGNAN 70 Query: 29 EQASWTIQ 6 EQ W +Q Sbjct: 71 EQCKWAMQ 78