BLASTX nr result
ID: Papaver31_contig00026752
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00026752 (998 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN81442.1| hypothetical protein VITISV_011546 [Vitis vinifera] 40 4e-06 >emb|CAN81442.1| hypothetical protein VITISV_011546 [Vitis vinifera] Length = 843 Score = 40.4 bits (93), Expect(3) = 4e-06 Identities = 13/58 (22%), Positives = 29/58 (50%) Frame = +3 Query: 534 CCFCDEDDETSSHLFYECWRTRRIWDYFIEGCRFDWTYNSNVTTNVKSWKFNWGDERL 707 C C E++E++ H+ C +TR +W + W + ++V + WK ++++ Sbjct: 723 CVLCKENEESTDHILIHCGKTRELWTVVLSSFGVVWVFPNSVRNLLLEWKIKGLEKKM 780 Score = 34.3 bits (77), Expect(3) = 4e-06 Identities = 9/22 (40%), Positives = 16/22 (72%) Frame = +1 Query: 691 GVTKDLSQIWNNIPVAIWWCIW 756 G+ K +S +W +P+ ++WCIW Sbjct: 775 GLEKKMSVVWKMVPICLFWCIW 796 Score = 23.5 bits (49), Expect(3) = 4e-06 Identities = 8/15 (53%), Positives = 13/15 (86%) Frame = +2 Query: 752 YGERNARVFENKKKN 796 +GERN R+F+ K+K+ Sbjct: 796 WGERNRRMFQEKEKS 810