BLASTX nr result
ID: Papaver31_contig00025066
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00025066 (509 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012827466.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-06 gb|EYU19069.1| hypothetical protein MIMGU_mgv1a001971mg [Erythra... 59 1e-06 ref|XP_010275031.1| PREDICTED: pentatricopeptide repeat-containi... 59 2e-06 ref|XP_011096744.1| PREDICTED: pentatricopeptide repeat-containi... 57 4e-06 >ref|XP_012827466.1| PREDICTED: pentatricopeptide repeat-containing protein At1g30610, chloroplastic [Erythranthe guttatus] Length = 775 Score = 58.9 bits (141), Expect = 1e-06 Identities = 29/59 (49%), Positives = 41/59 (69%) Frame = -1 Query: 269 VFSVRRRKQPNFRTLNALPKGGEKILEKEFKFQPTFDEYLKAMESVKTCRENSPFKDSN 93 V + RR+KQ T +AL G +L+KEF F+P+F +YLKAMESVKT R+N+ ++N Sbjct: 39 VIAPRRKKQKIIATRSALSDGSGVVLDKEFDFEPSFGDYLKAMESVKTDRDNNNNNNNN 97 >gb|EYU19069.1| hypothetical protein MIMGU_mgv1a001971mg [Erythranthe guttata] Length = 732 Score = 58.9 bits (141), Expect = 1e-06 Identities = 29/59 (49%), Positives = 41/59 (69%) Frame = -1 Query: 269 VFSVRRRKQPNFRTLNALPKGGEKILEKEFKFQPTFDEYLKAMESVKTCRENSPFKDSN 93 V + RR+KQ T +AL G +L+KEF F+P+F +YLKAMESVKT R+N+ ++N Sbjct: 39 VIAPRRKKQKIIATRSALSDGSGVVLDKEFDFEPSFGDYLKAMESVKTDRDNNNNNNNN 97 >ref|XP_010275031.1| PREDICTED: pentatricopeptide repeat-containing protein At1g30610, chloroplastic [Nelumbo nucifera] Length = 1042 Score = 58.5 bits (140), Expect = 2e-06 Identities = 37/89 (41%), Positives = 53/89 (59%), Gaps = 8/89 (8%) Frame = -1 Query: 359 YGQTTYSNHGFFSIPKKKPMFEISL-TKKMNVFSVRRRKQPNFRTLNALPKG-------G 204 Y Q S+ GF +KP+ +++L TKK++ + + + R +N L +G Sbjct: 25 YFQNPSSSLGF--PVSRKPISKVALNTKKVSRIELFSLRASSCRIMNVLSEGEATNRSSS 82 Query: 203 EKILEKEFKFQPTFDEYLKAMESVKTCRE 117 + LEKEF+FQPTFDEYLKAMESVK +E Sbjct: 83 DGFLEKEFRFQPTFDEYLKAMESVKNIKE 111 >ref|XP_011096744.1| PREDICTED: pentatricopeptide repeat-containing protein At1g30610, chloroplastic [Sesamum indicum] Length = 769 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/65 (43%), Positives = 44/65 (67%) Frame = -1 Query: 287 LTKKMNVFSVRRRKQPNFRTLNALPKGGEKILEKEFKFQPTFDEYLKAMESVKTCRENSP 108 L K + + RR+K T +AL GG +L++EF+F+P+FDEYLKA+E+VK R+N+ Sbjct: 35 LRKPIVAIAPRRKKLDRVITRSALSDGGGVVLDQEFEFKPSFDEYLKALETVKIDRDNNG 94 Query: 107 FKDSN 93 + +N Sbjct: 95 DRSNN 99