BLASTX nr result
ID: Papaver31_contig00024032
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00024032 (906 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010101795.1| hypothetical protein L484_018753 [Morus nota... 60 3e-06 >ref|XP_010101795.1| hypothetical protein L484_018753 [Morus notabilis] gi|587901375|gb|EXB89650.1| hypothetical protein L484_018753 [Morus notabilis] Length = 204 Score = 59.7 bits (143), Expect = 3e-06 Identities = 48/151 (31%), Positives = 71/151 (47%), Gaps = 11/151 (7%) Frame = -3 Query: 853 LKEYLPDQEKIGRAITVVTHPAT---KELIKFFALP-PGGAQAYNIMAAVLKNPPSTSSH 686 L +Y P E + + VT+ A +E +KF +P PGGA ++I A+ ++ PS + Sbjct: 54 LSQYGPSGETMSKIPPFVTNLAVYSAEEALKFIPVPLPGGASGFSICKAIKRSWPSDA-- 111 Query: 685 TCLYENNKYKQVMEELMVLRDEKDRMQAEIEQIKNEIE-------YPKRLNSTSPARLRS 527 NK K ++ L+ E R+ E+ + KN IE Y S S Sbjct: 112 ------NKSKGGGVDVKALQAEVKRLNKELGECKNWIEQMEMNKKYCSDFESAKTPNSDS 165 Query: 526 SSTVEQKPEDVISLFMMKGFTVLDYRYDQVV 434 +S V +KPEDVI +FMMK F D +V Sbjct: 166 NSVVNRKPEDVIRVFMMKEFIGRQLLDDMIV 196