BLASTX nr result
ID: Papaver31_contig00023783
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00023783 (671 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010052574.1| PREDICTED: UDP-arabinose 4-epimerase 1 [Euca... 67 1e-13 ref|XP_002270765.1| PREDICTED: UDP-arabinose 4-epimerase 1 [Viti... 67 5e-13 ref|XP_009385042.1| PREDICTED: probable UDP-arabinose 4-epimeras... 65 1e-12 ref|XP_009393289.1| PREDICTED: probable UDP-arabinose 4-epimeras... 65 1e-12 ref|XP_009393290.1| PREDICTED: probable UDP-arabinose 4-epimeras... 65 1e-12 ref|XP_012451220.1| PREDICTED: UDP-arabinose 4-epimerase 1 [Goss... 65 1e-12 ref|XP_010941586.1| PREDICTED: probable UDP-arabinose 4-epimeras... 65 2e-12 ref|XP_008383358.1| PREDICTED: UDP-arabinose 4-epimerase 1 [Malu... 65 2e-12 ref|XP_010941587.1| PREDICTED: probable UDP-arabinose 4-epimeras... 65 2e-12 ref|XP_010926896.1| PREDICTED: probable UDP-arabinose 4-epimeras... 65 2e-12 ref|XP_011096740.1| PREDICTED: UDP-arabinose 4-epimerase 1 [Sesa... 65 2e-12 ref|XP_010941588.1| PREDICTED: probable UDP-arabinose 4-epimeras... 65 2e-12 ref|XP_010926897.1| PREDICTED: probable UDP-arabinose 4-epimeras... 65 2e-12 ref|XP_010941589.1| PREDICTED: probable UDP-arabinose 4-epimeras... 65 2e-12 ref|XP_010926898.1| PREDICTED: probable UDP-arabinose 4-epimeras... 65 2e-12 ref|XP_008349158.1| PREDICTED: UDP-arabinose 4-epimerase 1, part... 65 2e-12 gb|KHG29484.1| UDP-arabinose 4-epimerase 1 [Gossypium arboreum] 65 3e-12 ref|XP_012827591.1| PREDICTED: UDP-arabinose 4-epimerase 1 [Eryt... 65 3e-12 gb|EMS63751.1| putative UDP-arabinose 4-epimerase 1 [Triticum ur... 62 3e-12 ref|XP_008225692.1| PREDICTED: UDP-arabinose 4-epimerase 1 [Prun... 64 4e-12 >ref|XP_010052574.1| PREDICTED: UDP-arabinose 4-epimerase 1 [Eucalyptus grandis] gi|702320254|ref|XP_010052575.1| PREDICTED: UDP-arabinose 4-epimerase 1 [Eucalyptus grandis] gi|629111684|gb|KCW76644.1| hypothetical protein EUGRSUZ_D01025 [Eucalyptus grandis] Length = 414 Score = 67.0 bits (162), Expect(3) = 1e-13 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = -3 Query: 651 VGGSTLEPLRYYHNIRSNTLVVLEAMTAHGVTTLVYS 541 VG STLEPLRYYHNI SNTLVVLEAM AHGV TL+YS Sbjct: 160 VGESTLEPLRYYHNITSNTLVVLEAMAAHGVKTLIYS 196 Score = 34.7 bits (78), Expect(3) = 1e-13 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -1 Query: 539 STYDEPFKMPITEDTPQI 486 +TY EP KMPITEDTPQ+ Sbjct: 200 ATYGEPDKMPITEDTPQV 217 Score = 21.6 bits (44), Expect(3) = 1e-13 Identities = 7/10 (70%), Positives = 10/10 (100%) Frame = -2 Query: 499 ILLRYFNVVG 470 ++LRYFNV+G Sbjct: 245 MILRYFNVIG 254 >ref|XP_002270765.1| PREDICTED: UDP-arabinose 4-epimerase 1 [Vitis vinifera] gi|731405444|ref|XP_010655777.1| PREDICTED: UDP-arabinose 4-epimerase 1 [Vitis vinifera] gi|731405446|ref|XP_010655778.1| PREDICTED: UDP-arabinose 4-epimerase 1 [Vitis vinifera] gi|731405448|ref|XP_010655779.1| PREDICTED: UDP-arabinose 4-epimerase 1 [Vitis vinifera] gi|731405450|ref|XP_010655780.1| PREDICTED: UDP-arabinose 4-epimerase 1 [Vitis vinifera] gi|297740899|emb|CBI31081.3| unnamed protein product [Vitis vinifera] Length = 418 Score = 67.4 bits (163), Expect(3) = 5e-13 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = -3 Query: 651 VGGSTLEPLRYYHNIRSNTLVVLEAMTAHGVTTLVYS 541 VG STLEPLRYYHNI SNTLVVLEAM AHGV TL+YS Sbjct: 158 VGESTLEPLRYYHNITSNTLVVLEAMAAHGVNTLIYS 194 Score = 32.3 bits (72), Expect(3) = 5e-13 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -1 Query: 539 STYDEPFKMPITEDTPQI 486 +TY EP KMPITE TPQ+ Sbjct: 198 ATYGEPEKMPITEQTPQV 215 Score = 21.6 bits (44), Expect(3) = 5e-13 Identities = 7/10 (70%), Positives = 10/10 (100%) Frame = -2 Query: 499 ILLRYFNVVG 470 ++LRYFNV+G Sbjct: 243 MILRYFNVIG 252 >ref|XP_009385042.1| PREDICTED: probable UDP-arabinose 4-epimerase 2 [Musa acuminata subsp. malaccensis] gi|695075600|ref|XP_009385044.1| PREDICTED: probable UDP-arabinose 4-epimerase 2 [Musa acuminata subsp. malaccensis] Length = 423 Score = 65.5 bits (158), Expect(3) = 1e-12 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -3 Query: 651 VGGSTLEPLRYYHNIRSNTLVVLEAMTAHGVTTLVYS 541 VG STLEPLRYYHNI +NTLV+LEAM AHGV TL+YS Sbjct: 164 VGESTLEPLRYYHNITANTLVILEAMAAHGVKTLIYS 200 Score = 32.7 bits (73), Expect(3) = 1e-12 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -1 Query: 539 STYDEPFKMPITEDTPQI 486 +TY EP KMPITE+TPQ+ Sbjct: 204 ATYGEPEKMPITEETPQL 221 Score = 21.6 bits (44), Expect(3) = 1e-12 Identities = 7/10 (70%), Positives = 10/10 (100%) Frame = -2 Query: 499 ILLRYFNVVG 470 ++LRYFNV+G Sbjct: 249 MILRYFNVIG 258 >ref|XP_009393289.1| PREDICTED: probable UDP-arabinose 4-epimerase 2 isoform X1 [Musa acuminata subsp. malaccensis] Length = 423 Score = 65.5 bits (158), Expect(3) = 1e-12 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -3 Query: 651 VGGSTLEPLRYYHNIRSNTLVVLEAMTAHGVTTLVYS 541 VG STLEPLRYYHNI +NTLV+LEAM AHGV TL+YS Sbjct: 164 VGESTLEPLRYYHNITANTLVILEAMAAHGVKTLIYS 200 Score = 32.7 bits (73), Expect(3) = 1e-12 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -1 Query: 539 STYDEPFKMPITEDTPQI 486 +TY EP KMPITE+TPQ+ Sbjct: 204 ATYGEPEKMPITEETPQL 221 Score = 21.6 bits (44), Expect(3) = 1e-12 Identities = 7/10 (70%), Positives = 10/10 (100%) Frame = -2 Query: 499 ILLRYFNVVG 470 ++LRYFNV+G Sbjct: 249 MILRYFNVIG 258 >ref|XP_009393290.1| PREDICTED: probable UDP-arabinose 4-epimerase 2 isoform X2 [Musa acuminata subsp. malaccensis] Length = 417 Score = 65.5 bits (158), Expect(3) = 1e-12 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -3 Query: 651 VGGSTLEPLRYYHNIRSNTLVVLEAMTAHGVTTLVYS 541 VG STLEPLRYYHNI +NTLV+LEAM AHGV TL+YS Sbjct: 158 VGESTLEPLRYYHNITANTLVILEAMAAHGVKTLIYS 194 Score = 32.7 bits (73), Expect(3) = 1e-12 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -1 Query: 539 STYDEPFKMPITEDTPQI 486 +TY EP KMPITE+TPQ+ Sbjct: 198 ATYGEPEKMPITEETPQL 215 Score = 21.6 bits (44), Expect(3) = 1e-12 Identities = 7/10 (70%), Positives = 10/10 (100%) Frame = -2 Query: 499 ILLRYFNVVG 470 ++LRYFNV+G Sbjct: 243 MILRYFNVIG 252 >ref|XP_012451220.1| PREDICTED: UDP-arabinose 4-epimerase 1 [Gossypium raimondii] gi|823237133|ref|XP_012451222.1| PREDICTED: UDP-arabinose 4-epimerase 1 [Gossypium raimondii] gi|823237135|ref|XP_012451223.1| PREDICTED: UDP-arabinose 4-epimerase 1 [Gossypium raimondii] gi|823237137|ref|XP_012451224.1| PREDICTED: UDP-arabinose 4-epimerase 1 [Gossypium raimondii] gi|823237139|ref|XP_012451225.1| PREDICTED: UDP-arabinose 4-epimerase 1 [Gossypium raimondii] gi|823237141|ref|XP_012451226.1| PREDICTED: UDP-arabinose 4-epimerase 1 [Gossypium raimondii] gi|763801036|gb|KJB67991.1| hypothetical protein B456_010G220700 [Gossypium raimondii] gi|763801037|gb|KJB67992.1| hypothetical protein B456_010G220700 [Gossypium raimondii] gi|763801038|gb|KJB67993.1| hypothetical protein B456_010G220700 [Gossypium raimondii] Length = 412 Score = 65.1 bits (157), Expect(3) = 1e-12 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -3 Query: 651 VGGSTLEPLRYYHNIRSNTLVVLEAMTAHGVTTLVYS 541 VG STL+PL+YYHNI SNTLVVLEAM AHGV TL+YS Sbjct: 158 VGESTLDPLKYYHNITSNTLVVLEAMAAHGVNTLIYS 194 Score = 33.1 bits (74), Expect(3) = 1e-12 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -1 Query: 539 STYDEPFKMPITEDTPQI 486 +TY EP KMPITE+TPQ+ Sbjct: 198 ATYGEPEKMPITEETPQV 215 Score = 21.6 bits (44), Expect(3) = 1e-12 Identities = 7/10 (70%), Positives = 10/10 (100%) Frame = -2 Query: 499 ILLRYFNVVG 470 ++LRYFNV+G Sbjct: 243 MILRYFNVIG 252 >ref|XP_010941586.1| PREDICTED: probable UDP-arabinose 4-epimerase 3 isoform X1 [Elaeis guineensis] Length = 421 Score = 65.5 bits (158), Expect(3) = 2e-12 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -3 Query: 651 VGGSTLEPLRYYHNIRSNTLVVLEAMTAHGVTTLVYS 541 VG STLEPLRYYHNI +NTLV+LEAM AHGV TL+YS Sbjct: 162 VGESTLEPLRYYHNITANTLVILEAMAAHGVKTLIYS 198 Score = 32.0 bits (71), Expect(3) = 2e-12 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -1 Query: 539 STYDEPFKMPITEDTPQ 489 +TY EP KMPITE+TPQ Sbjct: 202 ATYGEPEKMPITEETPQ 218 Score = 21.6 bits (44), Expect(3) = 2e-12 Identities = 7/10 (70%), Positives = 10/10 (100%) Frame = -2 Query: 499 ILLRYFNVVG 470 ++LRYFNV+G Sbjct: 247 MILRYFNVIG 256 >ref|XP_008383358.1| PREDICTED: UDP-arabinose 4-epimerase 1 [Malus domestica] Length = 418 Score = 64.7 bits (156), Expect(3) = 2e-12 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -3 Query: 651 VGGSTLEPLRYYHNIRSNTLVVLEAMTAHGVTTLVYS 541 VG STL+PL+YYHNI SNTLVVLEAM AHGV TL+YS Sbjct: 158 VGESTLDPLKYYHNITSNTLVVLEAMAAHGVKTLIYS 194 Score = 32.7 bits (73), Expect(3) = 2e-12 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -1 Query: 539 STYDEPFKMPITEDTPQI 486 +TY EP KMPITE+TPQ+ Sbjct: 198 ATYGEPEKMPITEETPQL 215 Score = 21.6 bits (44), Expect(3) = 2e-12 Identities = 7/10 (70%), Positives = 10/10 (100%) Frame = -2 Query: 499 ILLRYFNVVG 470 ++LRYFNV+G Sbjct: 243 MILRYFNVIG 252 >ref|XP_010941587.1| PREDICTED: probable UDP-arabinose 4-epimerase 3 isoform X2 [Elaeis guineensis] Length = 417 Score = 65.5 bits (158), Expect(3) = 2e-12 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -3 Query: 651 VGGSTLEPLRYYHNIRSNTLVVLEAMTAHGVTTLVYS 541 VG STLEPLRYYHNI +NTLV+LEAM AHGV TL+YS Sbjct: 158 VGESTLEPLRYYHNITANTLVILEAMAAHGVKTLIYS 194 Score = 32.0 bits (71), Expect(3) = 2e-12 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -1 Query: 539 STYDEPFKMPITEDTPQ 489 +TY EP KMPITE+TPQ Sbjct: 198 ATYGEPEKMPITEETPQ 214 Score = 21.6 bits (44), Expect(3) = 2e-12 Identities = 7/10 (70%), Positives = 10/10 (100%) Frame = -2 Query: 499 ILLRYFNVVG 470 ++LRYFNV+G Sbjct: 243 MILRYFNVIG 252 >ref|XP_010926896.1| PREDICTED: probable UDP-arabinose 4-epimerase 2 isoform X1 [Elaeis guineensis] Length = 417 Score = 65.5 bits (158), Expect(3) = 2e-12 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -3 Query: 651 VGGSTLEPLRYYHNIRSNTLVVLEAMTAHGVTTLVYS 541 VG STLEPLRYYHNI +NTLV+LEAM AHGV TL+YS Sbjct: 158 VGESTLEPLRYYHNITANTLVILEAMAAHGVKTLIYS 194 Score = 32.0 bits (71), Expect(3) = 2e-12 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -1 Query: 539 STYDEPFKMPITEDTPQ 489 +TY EP KMPITE+TPQ Sbjct: 198 ATYGEPEKMPITEETPQ 214 Score = 21.6 bits (44), Expect(3) = 2e-12 Identities = 7/10 (70%), Positives = 10/10 (100%) Frame = -2 Query: 499 ILLRYFNVVG 470 ++LRYFNV+G Sbjct: 243 MILRYFNVIG 252 >ref|XP_011096740.1| PREDICTED: UDP-arabinose 4-epimerase 1 [Sesamum indicum] gi|747097544|ref|XP_011096741.1| PREDICTED: UDP-arabinose 4-epimerase 1 [Sesamum indicum] gi|747097546|ref|XP_011096742.1| PREDICTED: UDP-arabinose 4-epimerase 1 [Sesamum indicum] gi|747097548|ref|XP_011096743.1| PREDICTED: UDP-arabinose 4-epimerase 1 [Sesamum indicum] Length = 417 Score = 64.7 bits (156), Expect(3) = 2e-12 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -3 Query: 651 VGGSTLEPLRYYHNIRSNTLVVLEAMTAHGVTTLVYS 541 VG STL+PL+YYHNI SNTLVVLEAM AHGV TL+YS Sbjct: 158 VGESTLDPLKYYHNITSNTLVVLEAMAAHGVKTLIYS 194 Score = 32.7 bits (73), Expect(3) = 2e-12 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -1 Query: 539 STYDEPFKMPITEDTPQI 486 +TY EP KMPITE+TPQ+ Sbjct: 198 ATYGEPEKMPITEETPQL 215 Score = 21.6 bits (44), Expect(3) = 2e-12 Identities = 7/10 (70%), Positives = 10/10 (100%) Frame = -2 Query: 499 ILLRYFNVVG 470 ++LRYFNV+G Sbjct: 243 MILRYFNVIG 252 >ref|XP_010941588.1| PREDICTED: probable UDP-arabinose 4-epimerase 3 isoform X3 [Elaeis guineensis] Length = 410 Score = 65.5 bits (158), Expect(3) = 2e-12 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -3 Query: 651 VGGSTLEPLRYYHNIRSNTLVVLEAMTAHGVTTLVYS 541 VG STLEPLRYYHNI +NTLV+LEAM AHGV TL+YS Sbjct: 151 VGESTLEPLRYYHNITANTLVILEAMAAHGVKTLIYS 187 Score = 32.0 bits (71), Expect(3) = 2e-12 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -1 Query: 539 STYDEPFKMPITEDTPQ 489 +TY EP KMPITE+TPQ Sbjct: 191 ATYGEPEKMPITEETPQ 207 Score = 21.6 bits (44), Expect(3) = 2e-12 Identities = 7/10 (70%), Positives = 10/10 (100%) Frame = -2 Query: 499 ILLRYFNVVG 470 ++LRYFNV+G Sbjct: 236 MILRYFNVIG 245 >ref|XP_010926897.1| PREDICTED: probable UDP-arabinose 4-epimerase 3 isoform X2 [Elaeis guineensis] Length = 410 Score = 65.5 bits (158), Expect(3) = 2e-12 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -3 Query: 651 VGGSTLEPLRYYHNIRSNTLVVLEAMTAHGVTTLVYS 541 VG STLEPLRYYHNI +NTLV+LEAM AHGV TL+YS Sbjct: 151 VGESTLEPLRYYHNITANTLVILEAMAAHGVKTLIYS 187 Score = 32.0 bits (71), Expect(3) = 2e-12 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -1 Query: 539 STYDEPFKMPITEDTPQ 489 +TY EP KMPITE+TPQ Sbjct: 191 ATYGEPEKMPITEETPQ 207 Score = 21.6 bits (44), Expect(3) = 2e-12 Identities = 7/10 (70%), Positives = 10/10 (100%) Frame = -2 Query: 499 ILLRYFNVVG 470 ++LRYFNV+G Sbjct: 236 MILRYFNVIG 245 >ref|XP_010941589.1| PREDICTED: probable UDP-arabinose 4-epimerase 3 isoform X4 [Elaeis guineensis] Length = 396 Score = 65.5 bits (158), Expect(3) = 2e-12 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -3 Query: 651 VGGSTLEPLRYYHNIRSNTLVVLEAMTAHGVTTLVYS 541 VG STLEPLRYYHNI +NTLV+LEAM AHGV TL+YS Sbjct: 137 VGESTLEPLRYYHNITANTLVILEAMAAHGVKTLIYS 173 Score = 32.0 bits (71), Expect(3) = 2e-12 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -1 Query: 539 STYDEPFKMPITEDTPQ 489 +TY EP KMPITE+TPQ Sbjct: 177 ATYGEPEKMPITEETPQ 193 Score = 21.6 bits (44), Expect(3) = 2e-12 Identities = 7/10 (70%), Positives = 10/10 (100%) Frame = -2 Query: 499 ILLRYFNVVG 470 ++LRYFNV+G Sbjct: 222 MILRYFNVIG 231 >ref|XP_010926898.1| PREDICTED: probable UDP-arabinose 4-epimerase 3 isoform X3 [Elaeis guineensis] Length = 396 Score = 65.5 bits (158), Expect(3) = 2e-12 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -3 Query: 651 VGGSTLEPLRYYHNIRSNTLVVLEAMTAHGVTTLVYS 541 VG STLEPLRYYHNI +NTLV+LEAM AHGV TL+YS Sbjct: 137 VGESTLEPLRYYHNITANTLVILEAMAAHGVKTLIYS 173 Score = 32.0 bits (71), Expect(3) = 2e-12 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -1 Query: 539 STYDEPFKMPITEDTPQ 489 +TY EP KMPITE+TPQ Sbjct: 177 ATYGEPEKMPITEETPQ 193 Score = 21.6 bits (44), Expect(3) = 2e-12 Identities = 7/10 (70%), Positives = 10/10 (100%) Frame = -2 Query: 499 ILLRYFNVVG 470 ++LRYFNV+G Sbjct: 222 MILRYFNVIG 231 >ref|XP_008349158.1| PREDICTED: UDP-arabinose 4-epimerase 1, partial [Malus domestica] Length = 323 Score = 64.7 bits (156), Expect(3) = 2e-12 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -3 Query: 651 VGGSTLEPLRYYHNIRSNTLVVLEAMTAHGVTTLVYS 541 VG STL+PL+YYHNI SNTLVVLEAM AHGV TL+YS Sbjct: 63 VGESTLDPLKYYHNITSNTLVVLEAMAAHGVKTLIYS 99 Score = 32.7 bits (73), Expect(3) = 2e-12 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -1 Query: 539 STYDEPFKMPITEDTPQI 486 +TY EP KMPITE+TPQ+ Sbjct: 103 ATYGEPEKMPITEETPQL 120 Score = 21.6 bits (44), Expect(3) = 2e-12 Identities = 7/10 (70%), Positives = 10/10 (100%) Frame = -2 Query: 499 ILLRYFNVVG 470 ++LRYFNV+G Sbjct: 148 MILRYFNVIG 157 >gb|KHG29484.1| UDP-arabinose 4-epimerase 1 [Gossypium arboreum] Length = 418 Score = 65.1 bits (157), Expect(3) = 3e-12 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -3 Query: 651 VGGSTLEPLRYYHNIRSNTLVVLEAMTAHGVTTLVYS 541 VG STL+PL+YYHNI SNTLVVLEAM AHGV TL+YS Sbjct: 158 VGESTLDPLKYYHNITSNTLVVLEAMAAHGVNTLIYS 194 Score = 32.0 bits (71), Expect(3) = 3e-12 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -1 Query: 539 STYDEPFKMPITEDTPQ 489 +TY EP KMPITE+TPQ Sbjct: 198 ATYGEPEKMPITEETPQ 214 Score = 21.6 bits (44), Expect(3) = 3e-12 Identities = 7/10 (70%), Positives = 10/10 (100%) Frame = -2 Query: 499 ILLRYFNVVG 470 ++LRYFNV+G Sbjct: 249 MILRYFNVIG 258 >ref|XP_012827591.1| PREDICTED: UDP-arabinose 4-epimerase 1 [Erythranthe guttatus] gi|848927803|ref|XP_012827592.1| PREDICTED: UDP-arabinose 4-epimerase 1 [Erythranthe guttatus] gi|848927807|ref|XP_012827593.1| PREDICTED: UDP-arabinose 4-epimerase 1 [Erythranthe guttatus] gi|604299135|gb|EYU19070.1| hypothetical protein MIMGU_mgv1a007125mg [Erythranthe guttata] Length = 418 Score = 65.1 bits (157), Expect(3) = 3e-12 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = -3 Query: 651 VGGSTLEPLRYYHNIRSNTLVVLEAMTAHGVTTLVYS 541 VG STL+PL+YYHNI SNTLVVLEAM+AHGV TL+YS Sbjct: 158 VGESTLDPLKYYHNITSNTLVVLEAMSAHGVKTLIYS 194 Score = 32.0 bits (71), Expect(3) = 3e-12 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -1 Query: 539 STYDEPFKMPITEDTPQI 486 +TY EP KMPITE TPQ+ Sbjct: 198 ATYGEPDKMPITEKTPQV 215 Score = 21.6 bits (44), Expect(3) = 3e-12 Identities = 7/10 (70%), Positives = 10/10 (100%) Frame = -2 Query: 499 ILLRYFNVVG 470 ++LRYFNV+G Sbjct: 243 MILRYFNVIG 252 >gb|EMS63751.1| putative UDP-arabinose 4-epimerase 1 [Triticum urartu] Length = 345 Score = 62.0 bits (149), Expect(3) = 3e-12 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = -3 Query: 651 VGGSTLEPLRYYHNIRSNTLVVLEAMTAHGVTTLVYS 541 VG STLEPLRYYHNI +NTLVVLEAM H V TL+YS Sbjct: 76 VGESTLEPLRYYHNITANTLVVLEAMATHNVKTLIYS 112 Score = 35.0 bits (79), Expect(3) = 3e-12 Identities = 14/19 (73%), Positives = 17/19 (89%) Frame = -1 Query: 539 STYDEPFKMPITEDTPQIF 483 +TY EP KMPITE+TPQ+F Sbjct: 116 ATYGEPEKMPITEETPQLF 134 Score = 21.6 bits (44), Expect(3) = 3e-12 Identities = 7/10 (70%), Positives = 10/10 (100%) Frame = -2 Query: 499 ILLRYFNVVG 470 ++LRYFNV+G Sbjct: 171 MILRYFNVIG 180 >ref|XP_008225692.1| PREDICTED: UDP-arabinose 4-epimerase 1 [Prunus mume] Length = 417 Score = 63.5 bits (153), Expect(3) = 4e-12 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -3 Query: 651 VGGSTLEPLRYYHNIRSNTLVVLEAMTAHGVTTLVYS 541 VG STL+PL+YYHNI SNTLVVLE+M AHGV TL+YS Sbjct: 158 VGESTLDPLKYYHNITSNTLVVLESMAAHGVKTLIYS 194 Score = 33.1 bits (74), Expect(3) = 4e-12 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -1 Query: 539 STYDEPFKMPITEDTPQI 486 +TY EP KMPITE+TPQ+ Sbjct: 198 ATYGEPEKMPITEETPQV 215 Score = 21.6 bits (44), Expect(3) = 4e-12 Identities = 7/10 (70%), Positives = 10/10 (100%) Frame = -2 Query: 499 ILLRYFNVVG 470 ++LRYFNV+G Sbjct: 243 MILRYFNVIG 252