BLASTX nr result
ID: Papaver31_contig00023713
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00023713 (455 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004299333.1| PREDICTED: two-component response regulator-... 77 4e-12 ref|XP_014509971.1| PREDICTED: two-component response regulator-... 76 9e-12 ref|XP_014509970.1| PREDICTED: two-component response regulator-... 76 9e-12 gb|KOM33294.1| hypothetical protein LR48_Vigan01g285000 [Vigna a... 76 9e-12 ref|XP_012080307.1| PREDICTED: two-component response regulator-... 76 9e-12 ref|XP_012080306.1| PREDICTED: two-component response regulator-... 76 9e-12 ref|XP_010089894.1| Two-component response regulator-like protei... 75 1e-11 ref|XP_011047183.1| PREDICTED: two-component response regulator-... 75 1e-11 ref|XP_010547769.1| PREDICTED: two-component response regulator-... 75 1e-11 ref|XP_010547768.1| PREDICTED: two-component response regulator-... 75 1e-11 gb|AIT56195.1| timing of CAB expression 1 [Dimocarpus longan] 75 1e-11 ref|XP_008444691.1| PREDICTED: two-component response regulator-... 75 1e-11 gb|AID51407.1| pseudo-response regulator 1 [Populus trichocarpa] 75 1e-11 ref|XP_006374451.1| hypothetical protein POPTR_0015s07310g [Popu... 75 1e-11 ref|XP_004137419.1| PREDICTED: two-component response regulator-... 75 1e-11 gb|AEA50889.1| toc1 [Populus tremula] 75 1e-11 ref|XP_010523059.1| PREDICTED: two-component response regulator-... 75 2e-11 ref|XP_010030203.1| PREDICTED: two-component response regulator-... 75 2e-11 ref|XP_010030194.1| PREDICTED: two-component response regulator-... 75 2e-11 gb|KDO55476.1| hypothetical protein CISIN_1g0086491mg [Citrus si... 75 2e-11 >ref|XP_004299333.1| PREDICTED: two-component response regulator-like APRR1 [Fragaria vesca subsp. vesca] Length = 536 Score = 77.4 bits (189), Expect = 4e-12 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = -1 Query: 455 CFDKKIRYVNRKTLAERRARVRGQFVRQVNGVDVNLNGQPVT 330 CFDKKIRYVNRK LAERR RVRGQFVR+VNGVDV+LNGQP + Sbjct: 478 CFDKKIRYVNRKKLAERRPRVRGQFVRKVNGVDVDLNGQPAS 519 >ref|XP_014509971.1| PREDICTED: two-component response regulator-like APRR1 isoform X2 [Vigna radiata var. radiata] Length = 556 Score = 76.3 bits (186), Expect = 9e-12 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = -1 Query: 455 CFDKKIRYVNRKTLAERRARVRGQFVRQVNGVDVNLNGQPVT 330 CFDKKIRYVNRK LAERR RVRGQFVR++NGVDV+LNGQP + Sbjct: 494 CFDKKIRYVNRKRLAERRPRVRGQFVRKLNGVDVDLNGQPTS 535 >ref|XP_014509970.1| PREDICTED: two-component response regulator-like APRR1 isoform X1 [Vigna radiata var. radiata] Length = 570 Score = 76.3 bits (186), Expect = 9e-12 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = -1 Query: 455 CFDKKIRYVNRKTLAERRARVRGQFVRQVNGVDVNLNGQPVT 330 CFDKKIRYVNRK LAERR RVRGQFVR++NGVDV+LNGQP + Sbjct: 508 CFDKKIRYVNRKRLAERRPRVRGQFVRKLNGVDVDLNGQPTS 549 >gb|KOM33294.1| hypothetical protein LR48_Vigan01g285000 [Vigna angularis] Length = 534 Score = 76.3 bits (186), Expect = 9e-12 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = -1 Query: 455 CFDKKIRYVNRKTLAERRARVRGQFVRQVNGVDVNLNGQPVT 330 CFDKKIRYVNRK LAERR RVRGQFVR++NGVDV+LNGQP + Sbjct: 472 CFDKKIRYVNRKRLAERRPRVRGQFVRKLNGVDVDLNGQPTS 513 >ref|XP_012080307.1| PREDICTED: two-component response regulator-like APRR1 isoform X2 [Jatropha curcas] Length = 473 Score = 76.3 bits (186), Expect = 9e-12 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = -1 Query: 455 CFDKKIRYVNRKTLAERRARVRGQFVRQVNGVDVNLNGQPVT 330 CFDKKIRYVNRK LAERR RVRGQFVR+VNGV+V+LNGQP T Sbjct: 405 CFDKKIRYVNRKKLAERRPRVRGQFVRKVNGVNVDLNGQPST 446 >ref|XP_012080306.1| PREDICTED: two-component response regulator-like APRR1 isoform X1 [Jatropha curcas] gi|643721019|gb|KDP31283.1| hypothetical protein JCGZ_11659 [Jatropha curcas] Length = 556 Score = 76.3 bits (186), Expect = 9e-12 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = -1 Query: 455 CFDKKIRYVNRKTLAERRARVRGQFVRQVNGVDVNLNGQPVT 330 CFDKKIRYVNRK LAERR RVRGQFVR+VNGV+V+LNGQP T Sbjct: 488 CFDKKIRYVNRKKLAERRPRVRGQFVRKVNGVNVDLNGQPST 529 >ref|XP_010089894.1| Two-component response regulator-like protein [Morus notabilis] gi|587848275|gb|EXB38554.1| Two-component response regulator-like protein [Morus notabilis] Length = 568 Score = 75.5 bits (184), Expect = 1e-11 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = -1 Query: 455 CFDKKIRYVNRKTLAERRARVRGQFVRQVNGVDVNLNGQPVT 330 CFDKKIRYVNRK LAERR RVRGQFVR+VNGV+V+LNGQP + Sbjct: 500 CFDKKIRYVNRKRLAERRPRVRGQFVRKVNGVNVDLNGQPAS 541 >ref|XP_011047183.1| PREDICTED: two-component response regulator-like APRR1 [Populus euphratica] Length = 567 Score = 75.5 bits (184), Expect = 1e-11 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = -1 Query: 455 CFDKKIRYVNRKTLAERRARVRGQFVRQVNGVDVNLNGQPVT 330 CFDKKIRYVNRK LAERR RVRGQFVR+VNGV+V+LNGQP + Sbjct: 498 CFDKKIRYVNRKKLAERRPRVRGQFVRKVNGVNVDLNGQPAS 539 >ref|XP_010547769.1| PREDICTED: two-component response regulator-like APRR1 isoform X2 [Tarenaya hassleriana] Length = 533 Score = 75.5 bits (184), Expect = 1e-11 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = -1 Query: 455 CFDKKIRYVNRKTLAERRARVRGQFVRQVNGVDVNLNGQPVT 330 CFDKKIRYVNRK LAERR RVRGQFVR+VNGV+V+LNGQP + Sbjct: 465 CFDKKIRYVNRKRLAERRPRVRGQFVRKVNGVNVDLNGQPAS 506 >ref|XP_010547768.1| PREDICTED: two-component response regulator-like APRR1 isoform X1 [Tarenaya hassleriana] Length = 575 Score = 75.5 bits (184), Expect = 1e-11 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = -1 Query: 455 CFDKKIRYVNRKTLAERRARVRGQFVRQVNGVDVNLNGQPVT 330 CFDKKIRYVNRK LAERR RVRGQFVR+VNGV+V+LNGQP + Sbjct: 507 CFDKKIRYVNRKRLAERRPRVRGQFVRKVNGVNVDLNGQPAS 548 >gb|AIT56195.1| timing of CAB expression 1 [Dimocarpus longan] Length = 559 Score = 75.5 bits (184), Expect = 1e-11 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = -1 Query: 455 CFDKKIRYVNRKTLAERRARVRGQFVRQVNGVDVNLNGQPVT 330 CFDKKIRYVNRK LAERR RVRGQFVR+VNGV+V+LNGQP + Sbjct: 491 CFDKKIRYVNRKRLAERRPRVRGQFVRKVNGVNVDLNGQPAS 532 >ref|XP_008444691.1| PREDICTED: two-component response regulator-like APRR1 [Cucumis melo] gi|659066439|ref|XP_008444766.1| PREDICTED: two-component response regulator-like APRR1 [Cucumis melo] Length = 556 Score = 75.5 bits (184), Expect = 1e-11 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = -1 Query: 455 CFDKKIRYVNRKTLAERRARVRGQFVRQVNGVDVNLNGQPVT 330 CFDKKIRYVNRK LAERR RVRGQFVR+VNGV+V+LNGQP + Sbjct: 488 CFDKKIRYVNRKRLAERRPRVRGQFVRKVNGVNVDLNGQPAS 529 >gb|AID51407.1| pseudo-response regulator 1 [Populus trichocarpa] Length = 558 Score = 75.5 bits (184), Expect = 1e-11 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = -1 Query: 455 CFDKKIRYVNRKTLAERRARVRGQFVRQVNGVDVNLNGQPVT 330 CFDKKIRYVNRK LAERR RVRGQFVR+VNGV+V+LNGQP + Sbjct: 489 CFDKKIRYVNRKKLAERRPRVRGQFVRKVNGVNVDLNGQPAS 530 >ref|XP_006374451.1| hypothetical protein POPTR_0015s07310g [Populus trichocarpa] gi|550322215|gb|ERP52248.1| hypothetical protein POPTR_0015s07310g [Populus trichocarpa] Length = 541 Score = 75.5 bits (184), Expect = 1e-11 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = -1 Query: 455 CFDKKIRYVNRKTLAERRARVRGQFVRQVNGVDVNLNGQPVT 330 CFDKKIRYVNRK LAERR RVRGQFVR+VNGV+V+LNGQP + Sbjct: 472 CFDKKIRYVNRKKLAERRPRVRGQFVRKVNGVNVDLNGQPAS 513 >ref|XP_004137419.1| PREDICTED: two-component response regulator-like APRR1 [Cucumis sativus] gi|778656898|ref|XP_011649905.1| PREDICTED: two-component response regulator-like APRR1 [Cucumis sativus] gi|778656903|ref|XP_011649915.1| PREDICTED: two-component response regulator-like APRR1 [Cucumis sativus] gi|700208924|gb|KGN64020.1| hypothetical protein Csa_1G038380 [Cucumis sativus] Length = 557 Score = 75.5 bits (184), Expect = 1e-11 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = -1 Query: 455 CFDKKIRYVNRKTLAERRARVRGQFVRQVNGVDVNLNGQPVT 330 CFDKKIRYVNRK LAERR RVRGQFVR+VNGV+V+LNGQP + Sbjct: 489 CFDKKIRYVNRKRLAERRPRVRGQFVRKVNGVNVDLNGQPAS 530 >gb|AEA50889.1| toc1 [Populus tremula] Length = 336 Score = 75.5 bits (184), Expect = 1e-11 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = -1 Query: 455 CFDKKIRYVNRKTLAERRARVRGQFVRQVNGVDVNLNGQPVT 330 CFDKKIRYVNRK LAERR RVRGQFVR+VNGV+V+LNGQP + Sbjct: 267 CFDKKIRYVNRKKLAERRPRVRGQFVRKVNGVNVDLNGQPAS 308 >ref|XP_010523059.1| PREDICTED: two-component response regulator-like APRR1 [Tarenaya hassleriana] Length = 543 Score = 75.1 bits (183), Expect = 2e-11 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = -1 Query: 455 CFDKKIRYVNRKTLAERRARVRGQFVRQVNGVDVNLNGQP 336 CFDKKIRYVNRK LAERR RVRGQFVR+VNGV+V+LNGQP Sbjct: 475 CFDKKIRYVNRKRLAERRPRVRGQFVRKVNGVNVDLNGQP 514 >ref|XP_010030203.1| PREDICTED: two-component response regulator-like APRR1 isoform X2 [Eucalyptus grandis] Length = 518 Score = 75.1 bits (183), Expect = 2e-11 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = -1 Query: 455 CFDKKIRYVNRKTLAERRARVRGQFVRQVNGVDVNLNGQP 336 CFDKKIRYVNRK LAERR RVRGQFVR+VNGV+V+LNGQP Sbjct: 448 CFDKKIRYVNRKRLAERRPRVRGQFVRKVNGVNVDLNGQP 487 >ref|XP_010030194.1| PREDICTED: two-component response regulator-like APRR1 isoform X1 [Eucalyptus grandis] Length = 572 Score = 75.1 bits (183), Expect = 2e-11 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = -1 Query: 455 CFDKKIRYVNRKTLAERRARVRGQFVRQVNGVDVNLNGQP 336 CFDKKIRYVNRK LAERR RVRGQFVR+VNGV+V+LNGQP Sbjct: 502 CFDKKIRYVNRKRLAERRPRVRGQFVRKVNGVNVDLNGQP 541 >gb|KDO55476.1| hypothetical protein CISIN_1g0086491mg [Citrus sinensis] Length = 353 Score = 75.1 bits (183), Expect = 2e-11 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = -1 Query: 455 CFDKKIRYVNRKTLAERRARVRGQFVRQVNGVDVNLNGQP 336 CFDKKIRYVNRK LAERR RVRGQFVR+VNGV+V+LNGQP Sbjct: 285 CFDKKIRYVNRKRLAERRPRVRGQFVRKVNGVNVDLNGQP 324