BLASTX nr result
ID: Papaver31_contig00023361
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00023361 (800 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB31589.1| hypothetical protein B456_005G198700 [Gossypium r... 60 2e-06 ref|XP_012479652.1| PREDICTED: prohibitin-1, mitochondrial [Goss... 60 2e-06 ref|XP_011047713.1| PREDICTED: prohibitin-1, mitochondrial isofo... 60 2e-06 ref|XP_011047712.1| PREDICTED: prohibitin-1, mitochondrial isofo... 60 2e-06 ref|XP_002517841.1| prohibitin, putative [Ricinus communis] gi|2... 60 2e-06 ref|XP_006446716.1| hypothetical protein CICLE_v10016485mg [Citr... 60 2e-06 ref|XP_006446715.1| hypothetical protein CICLE_v10016485mg [Citr... 60 2e-06 ref|XP_002310417.1| PROHIBITIN 2 family protein [Populus trichoc... 60 2e-06 ref|XP_014491666.1| PREDICTED: prohibitin-1, mitochondrial [Vign... 59 3e-06 ref|XP_014523213.1| PREDICTED: prohibitin-1, mitochondrial-like ... 59 3e-06 gb|KOM51181.1| hypothetical protein LR48_Vigan08g200800 [Vigna a... 59 3e-06 gb|KOM43750.1| hypothetical protein LR48_Vigan05g135500 [Vigna a... 59 3e-06 ref|XP_010093969.1| hypothetical protein L484_010535 [Morus nota... 59 3e-06 ref|XP_012851667.1| PREDICTED: prohibitin-1, mitochondrial-like ... 59 3e-06 ref|XP_011101531.1| PREDICTED: prohibitin-1, mitochondrial-like ... 59 3e-06 ref|XP_011101530.1| PREDICTED: prohibitin-1, mitochondrial-like ... 59 3e-06 gb|KHN27917.1| Prohibitin-2 [Glycine soja] 59 3e-06 gb|KHN43644.1| Prohibitin-2 [Glycine soja] gi|947090372|gb|KRH39... 59 3e-06 ref|XP_010696451.1| PREDICTED: prohibitin-1, mitochondrial-like ... 59 3e-06 ref|XP_010673826.1| PREDICTED: prohibitin-1, mitochondrial-like ... 59 3e-06 >gb|KJB31589.1| hypothetical protein B456_005G198700 [Gossypium raimondii] Length = 298 Score = 60.1 bits (144), Expect = 2e-06 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = -1 Query: 794 WFERPVIYDVRARPHLVESTSRSRDLQVVHLRDLYITYLKSS 669 WFERP+IYDVRARPHLVESTS SRDLQ+V + +T KS+ Sbjct: 80 WFERPIIYDVRARPHLVESTSGSRDLQMVKIGLRVLTRPKST 121 >ref|XP_012479652.1| PREDICTED: prohibitin-1, mitochondrial [Gossypium raimondii] gi|823159638|ref|XP_012479653.1| PREDICTED: prohibitin-1, mitochondrial [Gossypium raimondii] gi|823254635|ref|XP_012459960.1| PREDICTED: prohibitin-1, mitochondrial [Gossypium raimondii] gi|823254637|ref|XP_012459961.1| PREDICTED: prohibitin-1, mitochondrial [Gossypium raimondii] gi|728844825|gb|KHG24268.1| Prohibitin-2 [Gossypium arboreum] gi|728848915|gb|KHG28358.1| Prohibitin-2 [Gossypium arboreum] gi|763764333|gb|KJB31587.1| hypothetical protein B456_005G198700 [Gossypium raimondii] gi|763764334|gb|KJB31588.1| hypothetical protein B456_005G198700 [Gossypium raimondii] gi|763764336|gb|KJB31590.1| hypothetical protein B456_005G198700 [Gossypium raimondii] gi|763809116|gb|KJB76018.1| hypothetical protein B456_012G067800 [Gossypium raimondii] gi|763809117|gb|KJB76019.1| hypothetical protein B456_012G067800 [Gossypium raimondii] gi|763809118|gb|KJB76020.1| hypothetical protein B456_012G067800 [Gossypium raimondii] gi|763809119|gb|KJB76021.1| hypothetical protein B456_012G067800 [Gossypium raimondii] Length = 289 Score = 60.1 bits (144), Expect = 2e-06 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = -1 Query: 794 WFERPVIYDVRARPHLVESTSRSRDLQVVHLRDLYITYLKSS 669 WFERP+IYDVRARPHLVESTS SRDLQ+V + +T KS+ Sbjct: 71 WFERPIIYDVRARPHLVESTSGSRDLQMVKIGLRVLTRPKST 112 >ref|XP_011047713.1| PREDICTED: prohibitin-1, mitochondrial isoform X2 [Populus euphratica] Length = 290 Score = 59.7 bits (143), Expect = 2e-06 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -1 Query: 800 VLWFERPVIYDVRARPHLVESTSRSRDLQVVHL 702 V WFERPVIYDVRARPHLVESTS SRDLQ+V + Sbjct: 69 VPWFERPVIYDVRARPHLVESTSGSRDLQMVKI 101 >ref|XP_011047712.1| PREDICTED: prohibitin-1, mitochondrial isoform X1 [Populus euphratica] Length = 290 Score = 59.7 bits (143), Expect = 2e-06 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -1 Query: 800 VLWFERPVIYDVRARPHLVESTSRSRDLQVVHL 702 V WFERPVIYDVRARPHLVESTS SRDLQ+V + Sbjct: 69 VPWFERPVIYDVRARPHLVESTSGSRDLQMVKI 101 >ref|XP_002517841.1| prohibitin, putative [Ricinus communis] gi|223542823|gb|EEF44359.1| prohibitin, putative [Ricinus communis] Length = 290 Score = 59.7 bits (143), Expect = 2e-06 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -1 Query: 800 VLWFERPVIYDVRARPHLVESTSRSRDLQVVHL 702 V WFERPVIYDVRARPHLVESTS SRDLQ+V + Sbjct: 69 VPWFERPVIYDVRARPHLVESTSGSRDLQMVKI 101 >ref|XP_006446716.1| hypothetical protein CICLE_v10016485mg [Citrus clementina] gi|567908807|ref|XP_006446717.1| hypothetical protein CICLE_v10016485mg [Citrus clementina] gi|568829527|ref|XP_006469073.1| PREDICTED: prohibitin-1, mitochondrial-like [Citrus sinensis] gi|557549327|gb|ESR59956.1| hypothetical protein CICLE_v10016485mg [Citrus clementina] gi|557549328|gb|ESR59957.1| hypothetical protein CICLE_v10016485mg [Citrus clementina] gi|641830479|gb|KDO49566.1| hypothetical protein CISIN_1g022958mg [Citrus sinensis] Length = 289 Score = 59.7 bits (143), Expect = 2e-06 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -1 Query: 800 VLWFERPVIYDVRARPHLVESTSRSRDLQVVHL 702 V WFERPVIYDVRARPHLVESTS SRDLQ+V + Sbjct: 69 VPWFERPVIYDVRARPHLVESTSGSRDLQMVKI 101 >ref|XP_006446715.1| hypothetical protein CICLE_v10016485mg [Citrus clementina] gi|557549326|gb|ESR59955.1| hypothetical protein CICLE_v10016485mg [Citrus clementina] gi|641830480|gb|KDO49567.1| hypothetical protein CISIN_1g022958mg [Citrus sinensis] Length = 239 Score = 59.7 bits (143), Expect = 2e-06 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -1 Query: 800 VLWFERPVIYDVRARPHLVESTSRSRDLQVVHL 702 V WFERPVIYDVRARPHLVESTS SRDLQ+V + Sbjct: 19 VPWFERPVIYDVRARPHLVESTSGSRDLQMVKI 51 >ref|XP_002310417.1| PROHIBITIN 2 family protein [Populus trichocarpa] gi|118484973|gb|ABK94351.1| unknown [Populus trichocarpa] gi|222853320|gb|EEE90867.1| PROHIBITIN 2 family protein [Populus trichocarpa] Length = 290 Score = 59.7 bits (143), Expect = 2e-06 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -1 Query: 800 VLWFERPVIYDVRARPHLVESTSRSRDLQVVHL 702 V WFERPVIYDVRARPHLVESTS SRDLQ+V + Sbjct: 69 VPWFERPVIYDVRARPHLVESTSGSRDLQMVKI 101 >ref|XP_014491666.1| PREDICTED: prohibitin-1, mitochondrial [Vigna radiata var. radiata] gi|951072367|ref|XP_014491667.1| PREDICTED: prohibitin-1, mitochondrial [Vigna radiata var. radiata] Length = 289 Score = 59.3 bits (142), Expect = 3e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 794 WFERPVIYDVRARPHLVESTSRSRDLQVVHL 702 WFERPVIYDVRARPHLVESTS SRDLQ+V + Sbjct: 71 WFERPVIYDVRARPHLVESTSGSRDLQMVKI 101 >ref|XP_014523213.1| PREDICTED: prohibitin-1, mitochondrial-like [Vigna radiata var. radiata] Length = 290 Score = 59.3 bits (142), Expect = 3e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 794 WFERPVIYDVRARPHLVESTSRSRDLQVVHL 702 WFERPVIYDVRARPHLVESTS SRDLQ+V + Sbjct: 70 WFERPVIYDVRARPHLVESTSGSRDLQMVKI 100 >gb|KOM51181.1| hypothetical protein LR48_Vigan08g200800 [Vigna angularis] Length = 290 Score = 59.3 bits (142), Expect = 3e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 794 WFERPVIYDVRARPHLVESTSRSRDLQVVHL 702 WFERPVIYDVRARPHLVESTS SRDLQ+V + Sbjct: 70 WFERPVIYDVRARPHLVESTSGSRDLQMVKI 100 >gb|KOM43750.1| hypothetical protein LR48_Vigan05g135500 [Vigna angularis] Length = 289 Score = 59.3 bits (142), Expect = 3e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 794 WFERPVIYDVRARPHLVESTSRSRDLQVVHL 702 WFERPVIYDVRARPHLVESTS SRDLQ+V + Sbjct: 71 WFERPVIYDVRARPHLVESTSGSRDLQMVKI 101 >ref|XP_010093969.1| hypothetical protein L484_010535 [Morus notabilis] gi|587865406|gb|EXB54956.1| hypothetical protein L484_010535 [Morus notabilis] Length = 288 Score = 59.3 bits (142), Expect = 3e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 794 WFERPVIYDVRARPHLVESTSRSRDLQVVHL 702 WFERPVIYDVRARPHLVESTS SRDLQ+V + Sbjct: 70 WFERPVIYDVRARPHLVESTSGSRDLQMVKI 100 >ref|XP_012851667.1| PREDICTED: prohibitin-1, mitochondrial-like isoform X2 [Erythranthe guttatus] Length = 290 Score = 59.3 bits (142), Expect = 3e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 794 WFERPVIYDVRARPHLVESTSRSRDLQVVHL 702 WFERPVIYDVRARPHLVESTS SRDLQ+V + Sbjct: 71 WFERPVIYDVRARPHLVESTSGSRDLQMVKI 101 >ref|XP_011101531.1| PREDICTED: prohibitin-1, mitochondrial-like [Sesamum indicum] Length = 287 Score = 59.3 bits (142), Expect = 3e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 794 WFERPVIYDVRARPHLVESTSRSRDLQVVHL 702 WFERPVIYDVRARPHLVESTS SRDLQ+V + Sbjct: 71 WFERPVIYDVRARPHLVESTSGSRDLQMVKI 101 >ref|XP_011101530.1| PREDICTED: prohibitin-1, mitochondrial-like [Sesamum indicum] Length = 287 Score = 59.3 bits (142), Expect = 3e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 794 WFERPVIYDVRARPHLVESTSRSRDLQVVHL 702 WFERPVIYDVRARPHLVESTS SRDLQ+V + Sbjct: 71 WFERPVIYDVRARPHLVESTSGSRDLQMVKI 101 >gb|KHN27917.1| Prohibitin-2 [Glycine soja] Length = 336 Score = 59.3 bits (142), Expect = 3e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 794 WFERPVIYDVRARPHLVESTSRSRDLQVVHL 702 WFERPVIYDVRARPHLVESTS SRDLQ+V + Sbjct: 118 WFERPVIYDVRARPHLVESTSGSRDLQMVKI 148 >gb|KHN43644.1| Prohibitin-2 [Glycine soja] gi|947090372|gb|KRH39037.1| hypothetical protein GLYMA_09G173500 [Glycine max] Length = 289 Score = 59.3 bits (142), Expect = 3e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 794 WFERPVIYDVRARPHLVESTSRSRDLQVVHL 702 WFERPVIYDVRARPHLVESTS SRDLQ+V + Sbjct: 71 WFERPVIYDVRARPHLVESTSGSRDLQMVKI 101 >ref|XP_010696451.1| PREDICTED: prohibitin-1, mitochondrial-like [Beta vulgaris subsp. vulgaris] gi|870843827|gb|KMS96928.1| hypothetical protein BVRB_7g180450 [Beta vulgaris subsp. vulgaris] Length = 291 Score = 59.3 bits (142), Expect = 3e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 794 WFERPVIYDVRARPHLVESTSRSRDLQVVHL 702 WFERPVIYDVRARPHLVESTS SRDLQ+V + Sbjct: 71 WFERPVIYDVRARPHLVESTSGSRDLQMVKI 101 >ref|XP_010673826.1| PREDICTED: prohibitin-1, mitochondrial-like [Beta vulgaris subsp. vulgaris] gi|870863500|gb|KMT14664.1| hypothetical protein BVRB_4g074320 [Beta vulgaris subsp. vulgaris] Length = 291 Score = 59.3 bits (142), Expect = 3e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 794 WFERPVIYDVRARPHLVESTSRSRDLQVVHL 702 WFERPVIYDVRARPHLVESTS SRDLQ+V + Sbjct: 71 WFERPVIYDVRARPHLVESTSGSRDLQMVKI 101