BLASTX nr result
ID: Papaver31_contig00021977
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00021977 (780 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS68308.1| hypothetical protein M569_06451, partial [Genlise... 60 2e-06 ref|XP_010054753.1| PREDICTED: crooked neck-like protein 1 [Euca... 59 3e-06 gb|KCW77349.1| hypothetical protein EUGRSUZ_D01708 [Eucalyptus g... 59 3e-06 >gb|EPS68308.1| hypothetical protein M569_06451, partial [Genlisea aurea] Length = 679 Score = 59.7 bits (143), Expect = 2e-06 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -2 Query: 758 ENCYAWIKFAELEISLGETERTRAIFELATEQHHLD 651 ENCYAW K+AELEISL ETER RAIFELA +Q LD Sbjct: 480 ENCYAWTKYAELEISLSETERARAIFELAIDQPALD 515 >ref|XP_010054753.1| PREDICTED: crooked neck-like protein 1 [Eucalyptus grandis] Length = 517 Score = 59.3 bits (142), Expect = 3e-06 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -2 Query: 758 ENCYAWIKFAELEISLGETERTRAIFELATEQHHLD 651 ENCYAW K+AELEISLGET+R RAIFELA Q LD Sbjct: 301 ENCYAWSKYAELEISLGETDRARAIFELAIAQPALD 336 >gb|KCW77349.1| hypothetical protein EUGRSUZ_D01708 [Eucalyptus grandis] Length = 485 Score = 59.3 bits (142), Expect = 3e-06 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -2 Query: 758 ENCYAWIKFAELEISLGETERTRAIFELATEQHHLD 651 ENCYAW K+AELEISLGET+R RAIFELA Q LD Sbjct: 269 ENCYAWSKYAELEISLGETDRARAIFELAIAQPALD 304