BLASTX nr result
ID: Papaver31_contig00020654
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00020654 (904 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006857946.1| PREDICTED: ATPase ASNA1 homolog [Amborella t... 61 1e-06 gb|ABK23240.1| unknown [Picea sitchensis] 60 2e-06 >ref|XP_006857946.1| PREDICTED: ATPase ASNA1 homolog [Amborella trichopoda] gi|548862048|gb|ERN19413.1| hypothetical protein AMTR_s00069p00163470 [Amborella trichopoda] Length = 353 Score = 60.8 bits (146), Expect = 1e-06 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = +1 Query: 802 DDLPDVEGMDSFVSELANAIPGIDEAMSLAEMLE 903 D+LP+VEGMDSF+SEL NAIPGIDEAMS AEML+ Sbjct: 89 DELPNVEGMDSFISELTNAIPGIDEAMSFAEMLK 122 >gb|ABK23240.1| unknown [Picea sitchensis] Length = 374 Score = 60.5 bits (145), Expect = 2e-06 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +1 Query: 802 DDLPDVEGMDSFVSELANAIPGIDEAMSLAEMLE 903 DDLP+ EGM SFVSELANAIPGIDEAMS AEML+ Sbjct: 101 DDLPNAEGMSSFVSELANAIPGIDEAMSFAEMLK 134