BLASTX nr result
ID: Papaver31_contig00019305
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00019305 (960 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008785845.1| PREDICTED: 60S ribosomal protein L3 [Phoenix... 72 6e-10 emb|CBI18223.3| unnamed protein product [Vitis vinifera] 72 6e-10 ref|XP_010665150.1| PREDICTED: 60S ribosomal protein L3 [Vitis v... 72 6e-10 ref|XP_002524302.1| 60S ribosomal protein L3, putative [Ricinus ... 71 1e-09 gb|KMZ71700.1| putative 60S ribosomal protein L3 [Zostera marina] 71 1e-09 ref|XP_010087922.1| 60S ribosomal protein L3 [Morus notabilis] g... 71 1e-09 gb|KJB77952.1| hypothetical protein B456_012G169700 [Gossypium r... 71 1e-09 ref|XP_012459018.1| PREDICTED: 60S ribosomal protein L3-2 isofor... 71 1e-09 gb|KJB60016.1| hypothetical protein B456_009G285900 [Gossypium r... 71 1e-09 gb|KJB60015.1| hypothetical protein B456_009G285900 [Gossypium r... 71 1e-09 ref|XP_012446819.1| PREDICTED: 60S ribosomal protein L3 [Gossypi... 71 1e-09 gb|KJB28983.1| hypothetical protein B456_005G078300 [Gossypium r... 71 1e-09 ref|XP_011092302.1| PREDICTED: 60S ribosomal protein L3-2 [Sesam... 71 1e-09 ref|XP_011042876.1| PREDICTED: 60S ribosomal protein L3-1-like i... 71 1e-09 ref|XP_012482411.1| PREDICTED: 60S ribosomal protein L3 [Gossypi... 71 1e-09 gb|KHG10235.1| 60S ribosomal L3-2 -like protein [Gossypium arbor... 71 1e-09 gb|KHG02012.1| 60S ribosomal L3 [Gossypium arboreum] 71 1e-09 ref|XP_008445969.1| PREDICTED: 60S ribosomal protein L3-2 [Cucum... 71 1e-09 gb|KDO83773.1| hypothetical protein CISIN_1g038172mg, partial [C... 71 1e-09 gb|KDO44096.1| hypothetical protein CISIN_1g016467mg [Citrus sin... 71 1e-09 >ref|XP_008785845.1| PREDICTED: 60S ribosomal protein L3 [Phoenix dactylifera] Length = 389 Score = 72.0 bits (175), Expect = 6e-10 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = +1 Query: 460 VKSFPKDDPSKPCRLTAFLGYKARMTHIMREVEKHGS 570 VKSFPKDDP+KPCRLTAFLGYKA MTHI+REVEK GS Sbjct: 29 VKSFPKDDPTKPCRLTAFLGYKAGMTHIVREVEKPGS 65 >emb|CBI18223.3| unnamed protein product [Vitis vinifera] Length = 449 Score = 72.0 bits (175), Expect = 6e-10 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = +1 Query: 460 VKSFPKDDPSKPCRLTAFLGYKARMTHIMREVEKHGS 570 VK+FPKDDPSKPCRLTAFLGYKA MTHI+REVEK GS Sbjct: 89 VKAFPKDDPSKPCRLTAFLGYKAGMTHIVREVEKPGS 125 >ref|XP_010665150.1| PREDICTED: 60S ribosomal protein L3 [Vitis vinifera] gi|147833564|emb|CAN63848.1| hypothetical protein VITISV_039858 [Vitis vinifera] Length = 389 Score = 72.0 bits (175), Expect = 6e-10 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = +1 Query: 460 VKSFPKDDPSKPCRLTAFLGYKARMTHIMREVEKHGS 570 VK+FPKDDPSKPCRLTAFLGYKA MTHI+REVEK GS Sbjct: 29 VKAFPKDDPSKPCRLTAFLGYKAGMTHIVREVEKPGS 65 >ref|XP_002524302.1| 60S ribosomal protein L3, putative [Ricinus communis] gi|223536393|gb|EEF38042.1| 60S ribosomal protein L3, putative [Ricinus communis] Length = 389 Score = 71.2 bits (173), Expect = 1e-09 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +1 Query: 460 VKSFPKDDPSKPCRLTAFLGYKARMTHIMREVEKHGS 570 VK+FPKDDP+KPC+LTAFLGYKA MTHIMREVEK GS Sbjct: 29 VKAFPKDDPTKPCKLTAFLGYKAGMTHIMREVEKPGS 65 >gb|KMZ71700.1| putative 60S ribosomal protein L3 [Zostera marina] Length = 389 Score = 70.9 bits (172), Expect = 1e-09 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +1 Query: 460 VKSFPKDDPSKPCRLTAFLGYKARMTHIMREVEKHGS 570 VK+FPKDDPSKPC+LTAFLGYKA MTHI+REVEK GS Sbjct: 29 VKAFPKDDPSKPCKLTAFLGYKAGMTHIVREVEKPGS 65 >ref|XP_010087922.1| 60S ribosomal protein L3 [Morus notabilis] gi|587840118|gb|EXB30757.1| 60S ribosomal protein L3 [Morus notabilis] Length = 389 Score = 70.9 bits (172), Expect = 1e-09 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +1 Query: 460 VKSFPKDDPSKPCRLTAFLGYKARMTHIMREVEKHGS 570 VK+FPKDDP+KPCRLTAFLGYKA MTHI+REVEK GS Sbjct: 29 VKAFPKDDPTKPCRLTAFLGYKAGMTHIVREVEKPGS 65 >gb|KJB77952.1| hypothetical protein B456_012G169700 [Gossypium raimondii] Length = 304 Score = 70.9 bits (172), Expect = 1e-09 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +1 Query: 460 VKSFPKDDPSKPCRLTAFLGYKARMTHIMREVEKHGS 570 VK+FPKDDP+KPCRLTAFLGYKA MTHI+REVEK GS Sbjct: 29 VKAFPKDDPTKPCRLTAFLGYKAGMTHIVREVEKPGS 65 >ref|XP_012459018.1| PREDICTED: 60S ribosomal protein L3-2 isoform X1 [Gossypium raimondii] gi|763811048|gb|KJB77950.1| hypothetical protein B456_012G169700 [Gossypium raimondii] gi|763811051|gb|KJB77953.1| hypothetical protein B456_012G169700 [Gossypium raimondii] Length = 389 Score = 70.9 bits (172), Expect = 1e-09 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +1 Query: 460 VKSFPKDDPSKPCRLTAFLGYKARMTHIMREVEKHGS 570 VK+FPKDDP+KPCRLTAFLGYKA MTHI+REVEK GS Sbjct: 29 VKAFPKDDPTKPCRLTAFLGYKAGMTHIVREVEKPGS 65 >gb|KJB60016.1| hypothetical protein B456_009G285900 [Gossypium raimondii] Length = 376 Score = 70.9 bits (172), Expect = 1e-09 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +1 Query: 460 VKSFPKDDPSKPCRLTAFLGYKARMTHIMREVEKHGS 570 VK+FPKDDPSKPC+LTAFLGYKA MTHI+REVEK GS Sbjct: 16 VKAFPKDDPSKPCKLTAFLGYKAGMTHIVREVEKPGS 52 >gb|KJB60015.1| hypothetical protein B456_009G285900 [Gossypium raimondii] Length = 309 Score = 70.9 bits (172), Expect = 1e-09 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +1 Query: 460 VKSFPKDDPSKPCRLTAFLGYKARMTHIMREVEKHGS 570 VK+FPKDDPSKPC+LTAFLGYKA MTHI+REVEK GS Sbjct: 29 VKAFPKDDPSKPCKLTAFLGYKAGMTHIVREVEKPGS 65 >ref|XP_012446819.1| PREDICTED: 60S ribosomal protein L3 [Gossypium raimondii] gi|763793018|gb|KJB60014.1| hypothetical protein B456_009G285900 [Gossypium raimondii] Length = 389 Score = 70.9 bits (172), Expect = 1e-09 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +1 Query: 460 VKSFPKDDPSKPCRLTAFLGYKARMTHIMREVEKHGS 570 VK+FPKDDPSKPC+LTAFLGYKA MTHI+REVEK GS Sbjct: 29 VKAFPKDDPSKPCKLTAFLGYKAGMTHIVREVEKPGS 65 >gb|KJB28983.1| hypothetical protein B456_005G078300 [Gossypium raimondii] Length = 379 Score = 70.9 bits (172), Expect = 1e-09 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +1 Query: 460 VKSFPKDDPSKPCRLTAFLGYKARMTHIMREVEKHGS 570 VK+FPKDDPSKPC+LTAFLGYKA MTHI+REVEK GS Sbjct: 19 VKAFPKDDPSKPCKLTAFLGYKAGMTHIVREVEKPGS 55 >ref|XP_011092302.1| PREDICTED: 60S ribosomal protein L3-2 [Sesamum indicum] gi|747089342|ref|XP_011092303.1| PREDICTED: 60S ribosomal protein L3-2 [Sesamum indicum] Length = 389 Score = 70.9 bits (172), Expect = 1e-09 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +1 Query: 460 VKSFPKDDPSKPCRLTAFLGYKARMTHIMREVEKHGS 570 VK+FPKDDP+KPCRLTAFLGYKA MTHI+REVEK GS Sbjct: 29 VKAFPKDDPTKPCRLTAFLGYKAGMTHIVREVEKPGS 65 >ref|XP_011042876.1| PREDICTED: 60S ribosomal protein L3-1-like isoform X1 [Populus euphratica] gi|743899171|ref|XP_011042877.1| PREDICTED: 60S ribosomal protein L3-1-like isoform X2 [Populus euphratica] Length = 389 Score = 70.9 bits (172), Expect = 1e-09 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +1 Query: 460 VKSFPKDDPSKPCRLTAFLGYKARMTHIMREVEKHGS 570 VKSFPKDDP+KPC+LTAFLGYKA MTHI+REVEK GS Sbjct: 29 VKSFPKDDPTKPCKLTAFLGYKAGMTHIVREVEKPGS 65 >ref|XP_012482411.1| PREDICTED: 60S ribosomal protein L3 [Gossypium raimondii] gi|728834469|gb|KHG13912.1| 60S ribosomal L3 [Gossypium arboreum] gi|763761725|gb|KJB28979.1| hypothetical protein B456_005G078300 [Gossypium raimondii] Length = 389 Score = 70.9 bits (172), Expect = 1e-09 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +1 Query: 460 VKSFPKDDPSKPCRLTAFLGYKARMTHIMREVEKHGS 570 VK+FPKDDPSKPC+LTAFLGYKA MTHI+REVEK GS Sbjct: 29 VKAFPKDDPSKPCKLTAFLGYKAGMTHIVREVEKPGS 65 >gb|KHG10235.1| 60S ribosomal L3-2 -like protein [Gossypium arboreum] Length = 389 Score = 70.9 bits (172), Expect = 1e-09 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +1 Query: 460 VKSFPKDDPSKPCRLTAFLGYKARMTHIMREVEKHGS 570 VK+FPKDDP+KPCRLTAFLGYKA MTHI+REVEK GS Sbjct: 29 VKAFPKDDPTKPCRLTAFLGYKAGMTHIVREVEKPGS 65 >gb|KHG02012.1| 60S ribosomal L3 [Gossypium arboreum] Length = 389 Score = 70.9 bits (172), Expect = 1e-09 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +1 Query: 460 VKSFPKDDPSKPCRLTAFLGYKARMTHIMREVEKHGS 570 VK+FPKDDPSKPC+LTAFLGYKA MTHI+REVEK GS Sbjct: 29 VKAFPKDDPSKPCKLTAFLGYKAGMTHIVREVEKPGS 65 >ref|XP_008445969.1| PREDICTED: 60S ribosomal protein L3-2 [Cucumis melo] Length = 388 Score = 70.9 bits (172), Expect = 1e-09 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +1 Query: 460 VKSFPKDDPSKPCRLTAFLGYKARMTHIMREVEKHGS 570 VK+FP+DDPSKPCRLTAFLGYKA MTHI+REVEK GS Sbjct: 29 VKAFPRDDPSKPCRLTAFLGYKAGMTHIVREVEKPGS 65 >gb|KDO83773.1| hypothetical protein CISIN_1g038172mg, partial [Citrus sinensis] Length = 323 Score = 70.9 bits (172), Expect = 1e-09 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +1 Query: 460 VKSFPKDDPSKPCRLTAFLGYKARMTHIMREVEKHGS 570 VK+FPKDDPSKPCRLTAFLGYKA MTHI+R+VEK GS Sbjct: 49 VKAFPKDDPSKPCRLTAFLGYKAGMTHIVRDVEKPGS 85 >gb|KDO44096.1| hypothetical protein CISIN_1g016467mg [Citrus sinensis] Length = 303 Score = 70.9 bits (172), Expect = 1e-09 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +1 Query: 460 VKSFPKDDPSKPCRLTAFLGYKARMTHIMREVEKHGS 570 VK+FPKDDPSKPCRLTAFLGYKA MTHI+R+VEK GS Sbjct: 29 VKAFPKDDPSKPCRLTAFLGYKAGMTHIVRDVEKPGS 65