BLASTX nr result
ID: Papaver31_contig00019150
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00019150 (632 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMT12207.1| hypothetical protein F775_06030 [Aegilops tauschii] 54 4e-11 >gb|EMT12207.1| hypothetical protein F775_06030 [Aegilops tauschii] Length = 900 Score = 54.3 bits (129), Expect(2) = 4e-11 Identities = 24/36 (66%), Positives = 28/36 (77%) Frame = -2 Query: 112 KLSSRFLRLLSHCDWTFSPLIVDINGDMTLKDEMDI 5 ++ RFLRLLS DWTFSP+IVDIN D LKDE +I Sbjct: 683 RIGERFLRLLSSFDWTFSPMIVDINNDFNLKDEKEI 718 Score = 40.4 bits (93), Expect(2) = 4e-11 Identities = 24/48 (50%), Positives = 30/48 (62%), Gaps = 3/48 (6%) Frame = -1 Query: 245 STTQTPNYAFRSTSVFLPAPHPLANEKVKG*TSQERP---STCIQPVE 111 ST Q + AFR TSVF P PHPLA EK +SQ P +TC++ +E Sbjct: 612 STVQPLDSAFRHTSVFPPEPHPLAYEK----SSQRLPNFAATCVRSLE 655