BLASTX nr result
ID: Papaver31_contig00019006
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00019006 (893 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ETW23818.1| prolipoprotein diacylglyceryl transferase, partia... 58 8e-06 >gb|ETW23818.1| prolipoprotein diacylglyceryl transferase, partial [Mycobacterium gastri 'Wayne'] Length = 584 Score = 58.2 bits (139), Expect = 8e-06 Identities = 28/40 (70%), Positives = 32/40 (80%) Frame = -3 Query: 888 FKQKTAYEITYGDWSSDVCSSDLVRRRGALRILAVVVEAV 769 FKQKTAYEITYGDWSSDVCSSDL R AL I+ ++ A+ Sbjct: 1 FKQKTAYEITYGDWSSDVCSSDLPIRAYALFIITGIIVAL 40