BLASTX nr result
ID: Papaver31_contig00016900
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00016900 (525 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_039311068.1| hypothetical protein [Paenibacillus sp. IHB ... 58 3e-06 >ref|WP_039311068.1| hypothetical protein [Paenibacillus sp. IHB B 3415] gi|733494532|gb|KHL91155.1| hypothetical protein QW71_36290 [Paenibacillus sp. IHB B 3415] Length = 151 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = +2 Query: 419 GKIELEVEIKSSPEKFWEGICDSTVLFPKIFPEQY 523 GK+E+EVE+KS PEKFW GI +ST LFPK PE+Y Sbjct: 5 GKLEVEVELKSKPEKFWHGIRESTTLFPKAMPEEY 39