BLASTX nr result
ID: Papaver31_contig00016565
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00016565 (566 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010253199.1| PREDICTED: U-box domain-containing protein 1... 80 5e-13 ref|XP_012474669.1| PREDICTED: U-box domain-containing protein 1... 77 4e-12 ref|XP_006424807.1| hypothetical protein CICLE_v10027966mg [Citr... 77 6e-12 ref|XP_006424806.1| hypothetical protein CICLE_v10027966mg [Citr... 77 6e-12 ref|XP_002283992.1| PREDICTED: U-box domain-containing protein 1... 76 1e-11 gb|KHG14011.1| U-box domain-containing 13 -like protein [Gossypi... 76 1e-11 ref|XP_010106453.1| U-box domain-containing protein 13 [Morus no... 75 2e-11 gb|KHG05758.1| U-box domain-containing 13 -like protein [Gossypi... 75 2e-11 ref|XP_010252136.1| PREDICTED: U-box domain-containing protein 1... 75 2e-11 ref|XP_010252135.1| PREDICTED: U-box domain-containing protein 1... 75 2e-11 gb|KJB55896.1| hypothetical protein B456_009G100000 [Gossypium r... 74 4e-11 ref|XP_012445705.1| PREDICTED: U-box domain-containing protein 1... 74 4e-11 ref|XP_012445704.1| PREDICTED: U-box domain-containing protein 1... 74 4e-11 ref|XP_008223401.1| PREDICTED: U-box domain-containing protein 1... 74 4e-11 gb|EPS68981.1| hypothetical protein M569_05787, partial [Genlise... 74 5e-11 gb|KHN32120.1| U-box domain-containing protein 13 [Glycine soja] 74 6e-11 ref|XP_003539679.1| PREDICTED: U-box domain-containing protein 1... 74 6e-11 ref|XP_003537996.1| PREDICTED: U-box domain-containing protein 1... 74 6e-11 ref|XP_011089810.1| PREDICTED: U-box domain-containing protein 1... 73 8e-11 ref|XP_012065019.1| PREDICTED: U-box domain-containing protein 1... 73 8e-11 >ref|XP_010253199.1| PREDICTED: U-box domain-containing protein 13-like [Nelumbo nucifera] Length = 652 Score = 80.5 bits (197), Expect = 5e-13 Identities = 39/52 (75%), Positives = 46/52 (88%), Gaps = 1/52 (1%) Frame = -1 Query: 566 KYLAETQELGIMEPLLDLVQNGTDRGKRKAGQLLERMNRFIEHQKQ-QLQAQ 414 K+LAE QELG+M PLLDL QNGTDRGKRKA QL++RMNRF+E QKQ Q+QA+ Sbjct: 578 KHLAEAQELGVMGPLLDLAQNGTDRGKRKAAQLIDRMNRFVEQQKQVQVQAE 629 >ref|XP_012474669.1| PREDICTED: U-box domain-containing protein 13-like [Gossypium raimondii] gi|763741366|gb|KJB08865.1| hypothetical protein B456_001G109500 [Gossypium raimondii] Length = 669 Score = 77.4 bits (189), Expect = 4e-12 Identities = 38/52 (73%), Positives = 45/52 (86%), Gaps = 1/52 (1%) Frame = -1 Query: 566 KYLAETQELGIMEPLLDLVQNGTDRGKRKAGQLLERMNRFIEHQK-QQLQAQ 414 ++LAE QELG+M PL+DL QNGTDRGKRKA QLLERMNRF+E QK Q+QA+ Sbjct: 592 QHLAEAQELGVMGPLVDLAQNGTDRGKRKAAQLLERMNRFVEQQKLAQVQAE 643 >ref|XP_006424807.1| hypothetical protein CICLE_v10027966mg [Citrus clementina] gi|568870221|ref|XP_006488304.1| PREDICTED: U-box domain-containing protein 13-like [Citrus sinensis] gi|557526741|gb|ESR38047.1| hypothetical protein CICLE_v10027966mg [Citrus clementina] gi|641854076|gb|KDO72884.1| hypothetical protein CISIN_1g006099mg [Citrus sinensis] Length = 661 Score = 77.0 bits (188), Expect = 6e-12 Identities = 38/52 (73%), Positives = 45/52 (86%), Gaps = 1/52 (1%) Frame = -1 Query: 566 KYLAETQELGIMEPLLDLVQNGTDRGKRKAGQLLERMNRFIEHQKQ-QLQAQ 414 +YLAE +ELG+M PL+DL QNGTDRGKRKA QLLERM+RFIE QKQ Q+Q + Sbjct: 593 QYLAEAKELGVMGPLVDLAQNGTDRGKRKAAQLLERMSRFIEQQKQAQVQTE 644 >ref|XP_006424806.1| hypothetical protein CICLE_v10027966mg [Citrus clementina] gi|557526740|gb|ESR38046.1| hypothetical protein CICLE_v10027966mg [Citrus clementina] gi|641854077|gb|KDO72885.1| hypothetical protein CISIN_1g006099mg [Citrus sinensis] gi|641854078|gb|KDO72886.1| hypothetical protein CISIN_1g006099mg [Citrus sinensis] gi|641854079|gb|KDO72887.1| hypothetical protein CISIN_1g006099mg [Citrus sinensis] Length = 564 Score = 77.0 bits (188), Expect = 6e-12 Identities = 38/52 (73%), Positives = 45/52 (86%), Gaps = 1/52 (1%) Frame = -1 Query: 566 KYLAETQELGIMEPLLDLVQNGTDRGKRKAGQLLERMNRFIEHQKQ-QLQAQ 414 +YLAE +ELG+M PL+DL QNGTDRGKRKA QLLERM+RFIE QKQ Q+Q + Sbjct: 496 QYLAEAKELGVMGPLVDLAQNGTDRGKRKAAQLLERMSRFIEQQKQAQVQTE 547 >ref|XP_002283992.1| PREDICTED: U-box domain-containing protein 13 [Vitis vinifera] Length = 682 Score = 76.3 bits (186), Expect = 1e-11 Identities = 39/53 (73%), Positives = 44/53 (83%), Gaps = 3/53 (5%) Frame = -1 Query: 563 YLAETQELGIMEPLLDLVQNGTDRGKRKAGQLLERMNRFIEHQKQQ---LQAQ 414 +LAE QELG+M PL+DL QNGTDRGKRKA QLLERM RFIE Q+QQ +QAQ Sbjct: 593 HLAEAQELGVMGPLVDLAQNGTDRGKRKAAQLLERMGRFIEQQQQQQALVQAQ 645 >gb|KHG14011.1| U-box domain-containing 13 -like protein [Gossypium arboreum] Length = 671 Score = 75.9 bits (185), Expect = 1e-11 Identities = 38/52 (73%), Positives = 44/52 (84%), Gaps = 1/52 (1%) Frame = -1 Query: 566 KYLAETQELGIMEPLLDLVQNGTDRGKRKAGQLLERMNRFIEHQK-QQLQAQ 414 ++LAE QELG+M PLLDL QNGTDRGKRKA QLLERM+RF+E QK Q QA+ Sbjct: 592 QHLAEAQELGVMGPLLDLAQNGTDRGKRKAAQLLERMSRFVEQQKLAQAQAE 643 >ref|XP_010106453.1| U-box domain-containing protein 13 [Morus notabilis] gi|587923279|gb|EXC10629.1| U-box domain-containing protein 13 [Morus notabilis] Length = 664 Score = 75.5 bits (184), Expect = 2e-11 Identities = 37/52 (71%), Positives = 44/52 (84%), Gaps = 1/52 (1%) Frame = -1 Query: 566 KYLAETQELGIMEPLLDLVQNGTDRGKRKAGQLLERMNRFIEHQKQ-QLQAQ 414 ++L E QELG+M PL+DL QNGTDRGKRKA QLLERM+RF+E QKQ Q QA+ Sbjct: 596 QHLVEAQELGVMGPLVDLAQNGTDRGKRKAAQLLERMSRFVEQQKQAQAQAE 647 >gb|KHG05758.1| U-box domain-containing 13 -like protein [Gossypium arboreum] Length = 669 Score = 75.1 bits (183), Expect = 2e-11 Identities = 37/52 (71%), Positives = 44/52 (84%), Gaps = 1/52 (1%) Frame = -1 Query: 566 KYLAETQELGIMEPLLDLVQNGTDRGKRKAGQLLERMNRFIEHQK-QQLQAQ 414 ++LAE QELG+ PL+DL QNGTDRGKRKA QLLERMNRF+E QK Q+QA+ Sbjct: 592 QHLAEAQELGVKGPLVDLAQNGTDRGKRKAAQLLERMNRFVEQQKLAQVQAE 643 >ref|XP_010252136.1| PREDICTED: U-box domain-containing protein 13-like isoform X2 [Nelumbo nucifera] Length = 534 Score = 75.1 bits (183), Expect = 2e-11 Identities = 37/52 (71%), Positives = 46/52 (88%), Gaps = 1/52 (1%) Frame = -1 Query: 566 KYLAETQELGIMEPLLDLVQNGTDRGKRKAGQLLERMNRFIEHQKQ-QLQAQ 414 K++AE QELG+M+ LLDLVQNGTDRGKRKA QLL+R++RF+E QKQ Q QA+ Sbjct: 460 KHIAEAQELGLMDLLLDLVQNGTDRGKRKAAQLLDRISRFVEQQKQAQAQAE 511 >ref|XP_010252135.1| PREDICTED: U-box domain-containing protein 13-like isoform X1 [Nelumbo nucifera] Length = 652 Score = 75.1 bits (183), Expect = 2e-11 Identities = 37/52 (71%), Positives = 46/52 (88%), Gaps = 1/52 (1%) Frame = -1 Query: 566 KYLAETQELGIMEPLLDLVQNGTDRGKRKAGQLLERMNRFIEHQKQ-QLQAQ 414 K++AE QELG+M+ LLDLVQNGTDRGKRKA QLL+R++RF+E QKQ Q QA+ Sbjct: 578 KHIAEAQELGLMDLLLDLVQNGTDRGKRKAAQLLDRISRFVEQQKQAQAQAE 629 >gb|KJB55896.1| hypothetical protein B456_009G100000 [Gossypium raimondii] Length = 475 Score = 74.3 bits (181), Expect = 4e-11 Identities = 34/45 (75%), Positives = 40/45 (88%) Frame = -1 Query: 566 KYLAETQELGIMEPLLDLVQNGTDRGKRKAGQLLERMNRFIEHQK 432 ++LAE QELG+M PL+DL QNGTDRGKRKA QLLERM+RF+E QK Sbjct: 396 QHLAEAQELGVMGPLMDLAQNGTDRGKRKAAQLLERMSRFVEQQK 440 >ref|XP_012445705.1| PREDICTED: U-box domain-containing protein 13-like isoform X2 [Gossypium raimondii] gi|823225787|ref|XP_012445706.1| PREDICTED: U-box domain-containing protein 13-like isoform X2 [Gossypium raimondii] gi|823225789|ref|XP_012445707.1| PREDICTED: U-box domain-containing protein 13-like isoform X2 [Gossypium raimondii] gi|763788898|gb|KJB55894.1| hypothetical protein B456_009G100000 [Gossypium raimondii] gi|763788899|gb|KJB55895.1| hypothetical protein B456_009G100000 [Gossypium raimondii] Length = 574 Score = 74.3 bits (181), Expect = 4e-11 Identities = 34/45 (75%), Positives = 40/45 (88%) Frame = -1 Query: 566 KYLAETQELGIMEPLLDLVQNGTDRGKRKAGQLLERMNRFIEHQK 432 ++LAE QELG+M PL+DL QNGTDRGKRKA QLLERM+RF+E QK Sbjct: 495 QHLAEAQELGVMGPLMDLAQNGTDRGKRKAAQLLERMSRFVEQQK 539 >ref|XP_012445704.1| PREDICTED: U-box domain-containing protein 13-like isoform X1 [Gossypium raimondii] gi|763788897|gb|KJB55893.1| hypothetical protein B456_009G100000 [Gossypium raimondii] Length = 671 Score = 74.3 bits (181), Expect = 4e-11 Identities = 34/45 (75%), Positives = 40/45 (88%) Frame = -1 Query: 566 KYLAETQELGIMEPLLDLVQNGTDRGKRKAGQLLERMNRFIEHQK 432 ++LAE QELG+M PL+DL QNGTDRGKRKA QLLERM+RF+E QK Sbjct: 592 QHLAEAQELGVMGPLMDLAQNGTDRGKRKAAQLLERMSRFVEQQK 636 >ref|XP_008223401.1| PREDICTED: U-box domain-containing protein 13 [Prunus mume] Length = 666 Score = 74.3 bits (181), Expect = 4e-11 Identities = 34/51 (66%), Positives = 42/51 (82%) Frame = -1 Query: 566 KYLAETQELGIMEPLLDLVQNGTDRGKRKAGQLLERMNRFIEHQKQQLQAQ 414 +++ E QELG+M L++L QNGTDRGKRKA QLLER+NRF+E Q QQ QAQ Sbjct: 593 QHIVEAQELGVMGSLMELAQNGTDRGKRKAAQLLERINRFVEQQTQQAQAQ 643 >gb|EPS68981.1| hypothetical protein M569_05787, partial [Genlisea aurea] Length = 634 Score = 73.9 bits (180), Expect = 5e-11 Identities = 34/45 (75%), Positives = 40/45 (88%) Frame = -1 Query: 566 KYLAETQELGIMEPLLDLVQNGTDRGKRKAGQLLERMNRFIEHQK 432 +YLAE QELG+M PLLDL QNGT+RG+RKA QLLERMNR++E QK Sbjct: 587 QYLAEAQELGLMVPLLDLAQNGTERGRRKAAQLLERMNRYVETQK 631 >gb|KHN32120.1| U-box domain-containing protein 13 [Glycine soja] Length = 662 Score = 73.6 bits (179), Expect = 6e-11 Identities = 33/46 (71%), Positives = 41/46 (89%) Frame = -1 Query: 566 KYLAETQELGIMEPLLDLVQNGTDRGKRKAGQLLERMNRFIEHQKQ 429 +YLA+ QELG+M PLL+L QNGTDRGKRKAGQLLERM+R +E Q++ Sbjct: 592 QYLAQAQELGVMGPLLELAQNGTDRGKRKAGQLLERMSRLVEQQQE 637 >ref|XP_003539679.1| PREDICTED: U-box domain-containing protein 13-like [Glycine max] gi|947075967|gb|KRH24807.1| hypothetical protein GLYMA_12G063700 [Glycine max] Length = 662 Score = 73.6 bits (179), Expect = 6e-11 Identities = 33/46 (71%), Positives = 41/46 (89%) Frame = -1 Query: 566 KYLAETQELGIMEPLLDLVQNGTDRGKRKAGQLLERMNRFIEHQKQ 429 +YLA+ QELG+M PLL+L QNGTDRGKRKAGQLLERM+R +E Q++ Sbjct: 592 QYLAQAQELGVMGPLLELAQNGTDRGKRKAGQLLERMSRLVEQQQE 637 >ref|XP_003537996.1| PREDICTED: U-box domain-containing protein 13-like [Glycine max] gi|734378276|gb|KHN21961.1| U-box domain-containing protein 13 [Glycine soja] gi|947081018|gb|KRH29807.1| hypothetical protein GLYMA_11G140100 [Glycine max] Length = 661 Score = 73.6 bits (179), Expect = 6e-11 Identities = 33/46 (71%), Positives = 41/46 (89%) Frame = -1 Query: 566 KYLAETQELGIMEPLLDLVQNGTDRGKRKAGQLLERMNRFIEHQKQ 429 +YLA+ QELG+M PLL+L QNGTDRGKRKAGQLLERM+R +E Q++ Sbjct: 591 QYLAQAQELGVMGPLLELAQNGTDRGKRKAGQLLERMSRLVEQQQE 636 >ref|XP_011089810.1| PREDICTED: U-box domain-containing protein 13 [Sesamum indicum] Length = 663 Score = 73.2 bits (178), Expect = 8e-11 Identities = 34/46 (73%), Positives = 40/46 (86%) Frame = -1 Query: 566 KYLAETQELGIMEPLLDLVQNGTDRGKRKAGQLLERMNRFIEHQKQ 429 ++L E QELG+M PLLDL Q+GT+RGKRKA QLLERMNRF+E QKQ Sbjct: 593 QHLVEAQELGVMGPLLDLAQHGTERGKRKAAQLLERMNRFVETQKQ 638 >ref|XP_012065019.1| PREDICTED: U-box domain-containing protein 13-like [Jatropha curcas] gi|643738235|gb|KDP44223.1| hypothetical protein JCGZ_05690 [Jatropha curcas] Length = 663 Score = 73.2 bits (178), Expect = 8e-11 Identities = 36/54 (66%), Positives = 45/54 (83%), Gaps = 3/54 (5%) Frame = -1 Query: 566 KYLAETQELGIMEPLLDLVQNGTDRGKRKAGQLLERMNRFIEHQKQ---QLQAQ 414 K+LAE QELG+M L+DL QNGTDRGKRKA QLLERM+R++E QKQ Q+++Q Sbjct: 593 KHLAEAQELGVMGSLIDLAQNGTDRGKRKAQQLLERMSRYVEQQKQGQAQIESQ 646