BLASTX nr result
ID: Papaver31_contig00015738
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00015738 (644 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_014497643.1| PREDICTED: callose synthase 3-like [Vigna ra... 102 1e-19 gb|KRH01817.1| hypothetical protein GLYMA_18G300200 [Glycine max] 102 1e-19 gb|KOM28467.1| hypothetical protein LR48_Vigan549s002200 [Vigna ... 102 1e-19 gb|KHN24965.1| Callose synthase 3 [Glycine soja] 102 1e-19 gb|KHN12582.1| Callose synthase 3 [Glycine soja] 102 1e-19 ref|XP_007139111.1| hypothetical protein PHAVU_008G002300g [Phas... 102 1e-19 ref|XP_004491686.1| PREDICTED: callose synthase 3-like [Cicer ar... 102 1e-19 ref|XP_003551859.1| PREDICTED: callose synthase 3-like [Glycine ... 102 1e-19 ref|XP_003530905.1| PREDICTED: callose synthase 3-like [Glycine ... 102 1e-19 ref|XP_010087398.1| Callose synthase 3 [Morus notabilis] gi|5878... 101 3e-19 ref|XP_009364078.1| PREDICTED: callose synthase 3 isoform X3 [Py... 101 3e-19 ref|XP_009364077.1| PREDICTED: callose synthase 3 isoform X2 [Py... 101 3e-19 ref|XP_009364075.1| PREDICTED: callose synthase 3 isoform X1 [Py... 101 3e-19 ref|XP_009375102.1| PREDICTED: callose synthase 3-like [Pyrus x ... 101 3e-19 ref|XP_008344700.1| PREDICTED: callose synthase 3-like [Malus do... 101 3e-19 ref|XP_008352143.1| PREDICTED: LOW QUALITY PROTEIN: callose synt... 101 3e-19 ref|XP_008243622.1| PREDICTED: callose synthase 3 [Prunus mume] 101 3e-19 gb|KDO56430.1| hypothetical protein CISIN_1g0001712mg, partial [... 101 3e-19 ref|XP_006445915.1| hypothetical protein CICLE_v10014015mg [Citr... 101 3e-19 ref|XP_007208314.1| hypothetical protein PRUPE_ppa003008mg [Prun... 101 3e-19 >ref|XP_014497643.1| PREDICTED: callose synthase 3-like [Vigna radiata var. radiata] gi|950960393|ref|XP_014497644.1| PREDICTED: callose synthase 3-like [Vigna radiata var. radiata] Length = 1958 Score = 102 bits (255), Expect = 1e-19 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -1 Query: 644 LFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKERSSRNKE 495 LFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKERSSRNKE Sbjct: 1909 LFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKERSSRNKE 1958 >gb|KRH01817.1| hypothetical protein GLYMA_18G300200 [Glycine max] Length = 1927 Score = 102 bits (255), Expect = 1e-19 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -1 Query: 644 LFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKERSSRNKE 495 LFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKERSSRNKE Sbjct: 1878 LFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKERSSRNKE 1927 >gb|KOM28467.1| hypothetical protein LR48_Vigan549s002200 [Vigna angularis] Length = 1923 Score = 102 bits (255), Expect = 1e-19 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -1 Query: 644 LFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKERSSRNKE 495 LFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKERSSRNKE Sbjct: 1874 LFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKERSSRNKE 1923 >gb|KHN24965.1| Callose synthase 3 [Glycine soja] Length = 1958 Score = 102 bits (255), Expect = 1e-19 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -1 Query: 644 LFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKERSSRNKE 495 LFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKERSSRNKE Sbjct: 1909 LFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKERSSRNKE 1958 >gb|KHN12582.1| Callose synthase 3 [Glycine soja] Length = 1891 Score = 102 bits (255), Expect = 1e-19 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -1 Query: 644 LFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKERSSRNKE 495 LFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKERSSRNKE Sbjct: 1842 LFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKERSSRNKE 1891 >ref|XP_007139111.1| hypothetical protein PHAVU_008G002300g [Phaseolus vulgaris] gi|561012244|gb|ESW11105.1| hypothetical protein PHAVU_008G002300g [Phaseolus vulgaris] Length = 1958 Score = 102 bits (255), Expect = 1e-19 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -1 Query: 644 LFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKERSSRNKE 495 LFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKERSSRNKE Sbjct: 1909 LFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKERSSRNKE 1958 >ref|XP_004491686.1| PREDICTED: callose synthase 3-like [Cicer arietinum] Length = 1957 Score = 102 bits (255), Expect = 1e-19 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -1 Query: 644 LFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKERSSRNKE 495 LFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKERSSRNKE Sbjct: 1908 LFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKERSSRNKE 1957 >ref|XP_003551859.1| PREDICTED: callose synthase 3-like [Glycine max] gi|947052287|gb|KRH01816.1| hypothetical protein GLYMA_18G300200 [Glycine max] Length = 1958 Score = 102 bits (255), Expect = 1e-19 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -1 Query: 644 LFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKERSSRNKE 495 LFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKERSSRNKE Sbjct: 1909 LFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKERSSRNKE 1958 >ref|XP_003530905.1| PREDICTED: callose synthase 3-like [Glycine max] gi|947098286|gb|KRH46871.1| hypothetical protein GLYMA_08G361500 [Glycine max] Length = 1958 Score = 102 bits (255), Expect = 1e-19 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -1 Query: 644 LFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKERSSRNKE 495 LFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKERSSRNKE Sbjct: 1909 LFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKERSSRNKE 1958 >ref|XP_010087398.1| Callose synthase 3 [Morus notabilis] gi|587838299|gb|EXB29008.1| Callose synthase 3 [Morus notabilis] Length = 1951 Score = 101 bits (252), Expect = 3e-19 Identities = 49/50 (98%), Positives = 50/50 (100%) Frame = -1 Query: 644 LFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKERSSRNKE 495 LFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRK+RSSRNKE Sbjct: 1902 LFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKDRSSRNKE 1951 >ref|XP_009364078.1| PREDICTED: callose synthase 3 isoform X3 [Pyrus x bretschneideri] Length = 1655 Score = 101 bits (252), Expect = 3e-19 Identities = 49/50 (98%), Positives = 50/50 (100%) Frame = -1 Query: 644 LFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKERSSRNKE 495 LFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRK+RSSRNKE Sbjct: 1606 LFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKDRSSRNKE 1655 >ref|XP_009364077.1| PREDICTED: callose synthase 3 isoform X2 [Pyrus x bretschneideri] Length = 1908 Score = 101 bits (252), Expect = 3e-19 Identities = 49/50 (98%), Positives = 50/50 (100%) Frame = -1 Query: 644 LFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKERSSRNKE 495 LFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRK+RSSRNKE Sbjct: 1859 LFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKDRSSRNKE 1908 >ref|XP_009364075.1| PREDICTED: callose synthase 3 isoform X1 [Pyrus x bretschneideri] gi|694374207|ref|XP_009364076.1| PREDICTED: callose synthase 3 isoform X1 [Pyrus x bretschneideri] Length = 1958 Score = 101 bits (252), Expect = 3e-19 Identities = 49/50 (98%), Positives = 50/50 (100%) Frame = -1 Query: 644 LFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKERSSRNKE 495 LFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRK+RSSRNKE Sbjct: 1909 LFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKDRSSRNKE 1958 >ref|XP_009375102.1| PREDICTED: callose synthase 3-like [Pyrus x bretschneideri] Length = 1959 Score = 101 bits (252), Expect = 3e-19 Identities = 49/50 (98%), Positives = 50/50 (100%) Frame = -1 Query: 644 LFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKERSSRNKE 495 LFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRK+RSSRNKE Sbjct: 1910 LFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKDRSSRNKE 1959 >ref|XP_008344700.1| PREDICTED: callose synthase 3-like [Malus domestica] Length = 695 Score = 101 bits (252), Expect = 3e-19 Identities = 49/50 (98%), Positives = 50/50 (100%) Frame = -1 Query: 644 LFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKERSSRNKE 495 LFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRK+RSSRNKE Sbjct: 646 LFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKDRSSRNKE 695 >ref|XP_008352143.1| PREDICTED: LOW QUALITY PROTEIN: callose synthase 3-like [Malus domestica] Length = 1959 Score = 101 bits (252), Expect = 3e-19 Identities = 49/50 (98%), Positives = 50/50 (100%) Frame = -1 Query: 644 LFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKERSSRNKE 495 LFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRK+RSSRNKE Sbjct: 1910 LFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKDRSSRNKE 1959 >ref|XP_008243622.1| PREDICTED: callose synthase 3 [Prunus mume] Length = 1957 Score = 101 bits (252), Expect = 3e-19 Identities = 49/50 (98%), Positives = 50/50 (100%) Frame = -1 Query: 644 LFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKERSSRNKE 495 LFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRK+RSSRNKE Sbjct: 1908 LFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKDRSSRNKE 1957 >gb|KDO56430.1| hypothetical protein CISIN_1g0001712mg, partial [Citrus sinensis] Length = 1493 Score = 101 bits (252), Expect = 3e-19 Identities = 49/50 (98%), Positives = 50/50 (100%) Frame = -1 Query: 644 LFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKERSSRNKE 495 LFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRK+RSSRNKE Sbjct: 1444 LFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKDRSSRNKE 1493 >ref|XP_006445915.1| hypothetical protein CICLE_v10014015mg [Citrus clementina] gi|568879436|ref|XP_006492664.1| PREDICTED: callose synthase 3-like [Citrus sinensis] gi|557548526|gb|ESR59155.1| hypothetical protein CICLE_v10014015mg [Citrus clementina] Length = 1946 Score = 101 bits (252), Expect = 3e-19 Identities = 49/50 (98%), Positives = 50/50 (100%) Frame = -1 Query: 644 LFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKERSSRNKE 495 LFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRK+RSSRNKE Sbjct: 1897 LFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKDRSSRNKE 1946 >ref|XP_007208314.1| hypothetical protein PRUPE_ppa003008mg [Prunus persica] gi|462403956|gb|EMJ09513.1| hypothetical protein PRUPE_ppa003008mg [Prunus persica] Length = 612 Score = 101 bits (252), Expect = 3e-19 Identities = 49/50 (98%), Positives = 50/50 (100%) Frame = -1 Query: 644 LFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKERSSRNKE 495 LFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRK+RSSRNKE Sbjct: 563 LFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKDRSSRNKE 612