BLASTX nr result
ID: Papaver31_contig00012353
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00012353 (794 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010247729.1| PREDICTED: uncharacterized protein LOC104590... 59 4e-06 >ref|XP_010247729.1| PREDICTED: uncharacterized protein LOC104590694 [Nelumbo nucifera] Length = 365 Score = 58.9 bits (141), Expect = 4e-06 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = +2 Query: 2 FFALVSQHCIPLHSFRFVYHSLFASPHTES 91 FFALVSQHCIPLHSFRFVYHSLFAS ES Sbjct: 161 FFALVSQHCIPLHSFRFVYHSLFASAPVES 190