BLASTX nr result
ID: Papaver31_contig00012120
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00012120 (683 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KFK33537.1| hypothetical protein AALP_AA5G026400 [Arabis alpina] 78 6e-12 gb|KFK33536.1| hypothetical protein AALP_AA5G026200 [Arabis alpina] 78 6e-12 gb|ABK25784.1| unknown [Picea sitchensis] 77 1e-11 ref|XP_003558475.1| PREDICTED: 50S ribosomal protein L15, chloro... 75 3e-11 ref|XP_013714396.1| PREDICTED: 50S ribosomal protein L15, chloro... 75 5e-11 ref|XP_013711872.1| PREDICTED: 50S ribosomal protein L15, chloro... 75 5e-11 ref|XP_013677402.1| PREDICTED: 50S ribosomal protein L15, chloro... 75 5e-11 ref|XP_013598406.1| PREDICTED: 50S ribosomal protein L15, chloro... 75 5e-11 ref|XP_009114103.1| PREDICTED: 50S ribosomal protein L15, chloro... 75 5e-11 ref|XP_009152099.1| PREDICTED: 50S ribosomal protein L15, chloro... 75 5e-11 emb|CDX83573.1| BnaC07g23130D [Brassica napus] 75 5e-11 emb|CDY04186.1| BnaA09g19640D [Brassica napus] 75 5e-11 ref|XP_013644827.1| PREDICTED: 50S ribosomal protein L15, chloro... 75 5e-11 ref|XP_013606243.1| PREDICTED: 50S ribosomal protein L15, chloro... 75 5e-11 ref|XP_006395611.1| hypothetical protein EUTSA_v10004759mg [Eutr... 75 5e-11 ref|XP_006291665.1| hypothetical protein CARUB_v10017825mg [Caps... 74 6e-11 gb|EMT20721.1| putative 50S ribosomal protein L15, chloroplastic... 74 8e-11 gb|EMS60005.1| 50S ribosomal protein L15, chloroplastic [Triticu... 74 8e-11 dbj|BAJ94023.1| predicted protein [Hordeum vulgare subsp. vulgar... 74 8e-11 gb|KNA06817.1| hypothetical protein SOVF_177460 [Spinacia oleracea] 74 1e-10 >gb|KFK33537.1| hypothetical protein AALP_AA5G026400 [Arabis alpina] Length = 197 Score = 77.8 bits (190), Expect = 6e-12 Identities = 38/45 (84%), Positives = 43/45 (95%) Frame = -3 Query: 135 LAEVCTAGFKDGEEVSLESLKSKGLINPSGRERRLPLKILGTGDL 1 L +V TAGF+DG+EVSLE+LKSKGLINPSGRERRLPLKILGTG+L Sbjct: 81 LKDVETAGFEDGDEVSLETLKSKGLINPSGRERRLPLKILGTGEL 125 >gb|KFK33536.1| hypothetical protein AALP_AA5G026200 [Arabis alpina] Length = 443 Score = 77.8 bits (190), Expect = 6e-12 Identities = 38/45 (84%), Positives = 43/45 (95%) Frame = -3 Query: 135 LAEVCTAGFKDGEEVSLESLKSKGLINPSGRERRLPLKILGTGDL 1 L +V TAGF+DG+EVSLE+LKSKGLINPSGRERRLPLKILGTG+L Sbjct: 328 LKDVETAGFEDGDEVSLETLKSKGLINPSGRERRLPLKILGTGEL 372 >gb|ABK25784.1| unknown [Picea sitchensis] Length = 263 Score = 77.0 bits (188), Expect = 1e-11 Identities = 38/45 (84%), Positives = 41/45 (91%) Frame = -3 Query: 135 LAEVCTAGFKDGEEVSLESLKSKGLINPSGRERRLPLKILGTGDL 1 L ++ AGFKDGEEVSLESLKSKGLINPSGRERRLPLKILG G+L Sbjct: 159 LEDIEAAGFKDGEEVSLESLKSKGLINPSGRERRLPLKILGDGEL 203 >ref|XP_003558475.1| PREDICTED: 50S ribosomal protein L15, chloroplastic [Brachypodium distachyon] gi|721624173|ref|XP_010228960.1| PREDICTED: 50S ribosomal protein L15, chloroplastic [Brachypodium distachyon] gi|721624179|ref|XP_010228961.1| PREDICTED: 50S ribosomal protein L15, chloroplastic [Brachypodium distachyon] gi|721624182|ref|XP_010228962.1| PREDICTED: 50S ribosomal protein L15, chloroplastic [Brachypodium distachyon] gi|944087493|gb|KQK22845.1| hypothetical protein BRADI_1g69650 [Brachypodium distachyon] gi|944087494|gb|KQK22846.1| hypothetical protein BRADI_1g69650 [Brachypodium distachyon] gi|944087495|gb|KQK22847.1| hypothetical protein BRADI_1g69650 [Brachypodium distachyon] gi|944087496|gb|KQK22848.1| hypothetical protein BRADI_1g69650 [Brachypodium distachyon] gi|944087497|gb|KQK22849.1| hypothetical protein BRADI_1g69650 [Brachypodium distachyon] gi|944087498|gb|KQK22850.1| hypothetical protein BRADI_1g69650 [Brachypodium distachyon] gi|944087499|gb|KQK22851.1| hypothetical protein BRADI_1g69650 [Brachypodium distachyon] Length = 263 Score = 75.5 bits (184), Expect = 3e-11 Identities = 35/45 (77%), Positives = 40/45 (88%) Frame = -3 Query: 135 LAEVCTAGFKDGEEVSLESLKSKGLINPSGRERRLPLKILGTGDL 1 L ++ GFKDGEE+SLESLKSKGLINPSGRER+LPLKILG GD+ Sbjct: 153 LRDIAQGGFKDGEEISLESLKSKGLINPSGRERKLPLKILGDGDV 197 >ref|XP_013714396.1| PREDICTED: 50S ribosomal protein L15, chloroplastic-like isoform X1 [Brassica napus] gi|923885989|ref|XP_013714397.1| PREDICTED: 50S ribosomal protein L15, chloroplastic-like isoform X2 [Brassica napus] Length = 280 Score = 74.7 bits (182), Expect = 5e-11 Identities = 35/45 (77%), Positives = 42/45 (93%) Frame = -3 Query: 135 LAEVCTAGFKDGEEVSLESLKSKGLINPSGRERRLPLKILGTGDL 1 L ++ TAGF+DG+EVSLE+LK KGLINPSGRER+LPLKILGTG+L Sbjct: 166 LKDIETAGFEDGDEVSLETLKQKGLINPSGRERKLPLKILGTGEL 210 >ref|XP_013711872.1| PREDICTED: 50S ribosomal protein L15, chloroplastic [Brassica napus] Length = 279 Score = 74.7 bits (182), Expect = 5e-11 Identities = 35/45 (77%), Positives = 42/45 (93%) Frame = -3 Query: 135 LAEVCTAGFKDGEEVSLESLKSKGLINPSGRERRLPLKILGTGDL 1 L ++ TAGF+DG+EVSLE+LK KGLINPSGRER+LPLKILGTG+L Sbjct: 165 LKDIETAGFEDGDEVSLETLKQKGLINPSGRERKLPLKILGTGEL 209 >ref|XP_013677402.1| PREDICTED: 50S ribosomal protein L15, chloroplastic-like [Brassica napus] Length = 278 Score = 74.7 bits (182), Expect = 5e-11 Identities = 35/45 (77%), Positives = 42/45 (93%) Frame = -3 Query: 135 LAEVCTAGFKDGEEVSLESLKSKGLINPSGRERRLPLKILGTGDL 1 L ++ TAGF+DG+EVSLE+LK KGLINPSGRER+LPLKILGTG+L Sbjct: 164 LKDIETAGFEDGDEVSLETLKQKGLINPSGRERKLPLKILGTGEL 208 >ref|XP_013598406.1| PREDICTED: 50S ribosomal protein L15, chloroplastic [Brassica oleracea var. oleracea] Length = 277 Score = 74.7 bits (182), Expect = 5e-11 Identities = 35/45 (77%), Positives = 42/45 (93%) Frame = -3 Query: 135 LAEVCTAGFKDGEEVSLESLKSKGLINPSGRERRLPLKILGTGDL 1 L ++ TAGF+DG+EVSLE+LK KGLINPSGRER+LPLKILGTG+L Sbjct: 163 LKDIETAGFEDGDEVSLETLKQKGLINPSGRERKLPLKILGTGEL 207 >ref|XP_009114103.1| PREDICTED: 50S ribosomal protein L15, chloroplastic [Brassica rapa] Length = 280 Score = 74.7 bits (182), Expect = 5e-11 Identities = 35/45 (77%), Positives = 42/45 (93%) Frame = -3 Query: 135 LAEVCTAGFKDGEEVSLESLKSKGLINPSGRERRLPLKILGTGDL 1 L ++ TAGF+DG+EVSLE+LK KGLINPSGRER+LPLKILGTG+L Sbjct: 166 LKDIETAGFEDGDEVSLETLKQKGLINPSGRERKLPLKILGTGEL 210 >ref|XP_009152099.1| PREDICTED: 50S ribosomal protein L15, chloroplastic [Brassica rapa] Length = 270 Score = 74.7 bits (182), Expect = 5e-11 Identities = 35/45 (77%), Positives = 42/45 (93%) Frame = -3 Query: 135 LAEVCTAGFKDGEEVSLESLKSKGLINPSGRERRLPLKILGTGDL 1 L ++ TAGF+DG+EVSLE+LK KGLINPSGRER+LPLKILGTG+L Sbjct: 156 LKDIETAGFEDGDEVSLETLKQKGLINPSGRERKLPLKILGTGEL 200 >emb|CDX83573.1| BnaC07g23130D [Brassica napus] Length = 278 Score = 74.7 bits (182), Expect = 5e-11 Identities = 35/45 (77%), Positives = 42/45 (93%) Frame = -3 Query: 135 LAEVCTAGFKDGEEVSLESLKSKGLINPSGRERRLPLKILGTGDL 1 L ++ TAGF+DG+EVSLE+LK KGLINPSGRER+LPLKILGTG+L Sbjct: 164 LKDIETAGFEDGDEVSLETLKQKGLINPSGRERKLPLKILGTGEL 208 >emb|CDY04186.1| BnaA09g19640D [Brassica napus] Length = 279 Score = 74.7 bits (182), Expect = 5e-11 Identities = 35/45 (77%), Positives = 42/45 (93%) Frame = -3 Query: 135 LAEVCTAGFKDGEEVSLESLKSKGLINPSGRERRLPLKILGTGDL 1 L ++ TAGF+DG+EVSLE+LK KGLINPSGRER+LPLKILGTG+L Sbjct: 165 LKDIETAGFEDGDEVSLETLKQKGLINPSGRERKLPLKILGTGEL 209 >ref|XP_013644827.1| PREDICTED: 50S ribosomal protein L15, chloroplastic-like [Brassica napus] gi|923652370|ref|XP_013644829.1| PREDICTED: 50S ribosomal protein L15, chloroplastic-like [Brassica napus] gi|674919506|emb|CDY13600.1| BnaA06g33230D [Brassica napus] Length = 271 Score = 74.7 bits (182), Expect = 5e-11 Identities = 35/45 (77%), Positives = 42/45 (93%) Frame = -3 Query: 135 LAEVCTAGFKDGEEVSLESLKSKGLINPSGRERRLPLKILGTGDL 1 L ++ TAGF+DG+EVSLE+LK KGLINPSGRER+LPLKILGTG+L Sbjct: 156 LKDIETAGFEDGDEVSLETLKQKGLINPSGRERKLPLKILGTGEL 200 >ref|XP_013606243.1| PREDICTED: 50S ribosomal protein L15, chloroplastic-like [Brassica oleracea var. oleracea] gi|674855837|emb|CDY70691.1| BnaC09g52400D [Brassica napus] Length = 280 Score = 74.7 bits (182), Expect = 5e-11 Identities = 35/45 (77%), Positives = 42/45 (93%) Frame = -3 Query: 135 LAEVCTAGFKDGEEVSLESLKSKGLINPSGRERRLPLKILGTGDL 1 L ++ TAGF+DG+EVSLE+LK KGLINPSGRER+LPLKILGTG+L Sbjct: 166 LKDIETAGFEDGDEVSLETLKQKGLINPSGRERKLPLKILGTGEL 210 >ref|XP_006395611.1| hypothetical protein EUTSA_v10004759mg [Eutrema salsugineum] gi|557092250|gb|ESQ32897.1| hypothetical protein EUTSA_v10004759mg [Eutrema salsugineum] Length = 275 Score = 74.7 bits (182), Expect = 5e-11 Identities = 35/45 (77%), Positives = 42/45 (93%) Frame = -3 Query: 135 LAEVCTAGFKDGEEVSLESLKSKGLINPSGRERRLPLKILGTGDL 1 L ++ TAGF+DG+EVSLE+LK KGLINPSGRER+LPLKILGTG+L Sbjct: 165 LKDIETAGFEDGDEVSLETLKQKGLINPSGRERKLPLKILGTGEL 209 >ref|XP_006291665.1| hypothetical protein CARUB_v10017825mg [Capsella rubella] gi|482560372|gb|EOA24563.1| hypothetical protein CARUB_v10017825mg [Capsella rubella] Length = 273 Score = 74.3 bits (181), Expect = 6e-11 Identities = 35/45 (77%), Positives = 42/45 (93%) Frame = -3 Query: 135 LAEVCTAGFKDGEEVSLESLKSKGLINPSGRERRLPLKILGTGDL 1 L ++ TAGF++G+EVSLESLK KGLINPSGRER+LPLKILGTG+L Sbjct: 160 LKDIETAGFQEGDEVSLESLKQKGLINPSGRERKLPLKILGTGEL 204 >gb|EMT20721.1| putative 50S ribosomal protein L15, chloroplastic [Aegilops tauschii] Length = 159 Score = 73.9 bits (180), Expect = 8e-11 Identities = 34/45 (75%), Positives = 40/45 (88%) Frame = -3 Query: 135 LAEVCTAGFKDGEEVSLESLKSKGLINPSGRERRLPLKILGTGDL 1 L ++ GFKDG+E+SLESLKS+GLINPSGRER+LPLKILG GDL Sbjct: 49 LRDIVQGGFKDGDEISLESLKSRGLINPSGRERKLPLKILGDGDL 93 >gb|EMS60005.1| 50S ribosomal protein L15, chloroplastic [Triticum urartu] Length = 159 Score = 73.9 bits (180), Expect = 8e-11 Identities = 34/45 (75%), Positives = 40/45 (88%) Frame = -3 Query: 135 LAEVCTAGFKDGEEVSLESLKSKGLINPSGRERRLPLKILGTGDL 1 L ++ GFKDG+E+SLESLKS+GLINPSGRER+LPLKILG GDL Sbjct: 49 LRDIVQGGFKDGDEISLESLKSRGLINPSGRERKLPLKILGDGDL 93 >dbj|BAJ94023.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326505984|dbj|BAJ91231.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 261 Score = 73.9 bits (180), Expect = 8e-11 Identities = 34/45 (75%), Positives = 40/45 (88%) Frame = -3 Query: 135 LAEVCTAGFKDGEEVSLESLKSKGLINPSGRERRLPLKILGTGDL 1 L ++ GFKDG+E+SLESLKS+GLINPSGRER+LPLKILG GDL Sbjct: 151 LRDIVQGGFKDGDEISLESLKSRGLINPSGRERKLPLKILGDGDL 195 >gb|KNA06817.1| hypothetical protein SOVF_177460 [Spinacia oleracea] Length = 271 Score = 73.6 bits (179), Expect = 1e-10 Identities = 35/45 (77%), Positives = 41/45 (91%) Frame = -3 Query: 135 LAEVCTAGFKDGEEVSLESLKSKGLINPSGRERRLPLKILGTGDL 1 L ++ AGFK+GEEVSLESLK+KG+INPSGRERRLPLKILG G+L Sbjct: 162 LRDIEVAGFKEGEEVSLESLKAKGIINPSGRERRLPLKILGEGEL 206