BLASTX nr result
ID: Papaver31_contig00011592
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00011592 (523 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB32405.1| hypothetical protein B456_005G239600 [Gossypium r... 58 3e-06 >gb|KJB32405.1| hypothetical protein B456_005G239600 [Gossypium raimondii] Length = 57 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/61 (44%), Positives = 41/61 (67%) Frame = -2 Query: 390 MVIQRIELCIRMVRFAIEFVVIFVEAVGYALRENATSAVLTAPVPIPAHLTTYVPLVGFL 211 MV+Q++E+C+ +++ A+EFVV+ EAVG + +N + V+TA T VPLVGFL Sbjct: 1 MVLQKLEMCVELMKLAVEFVVVVAEAVGIVIHQNHSPPVMTA----SRSFATPVPLVGFL 56 Query: 210 P 208 P Sbjct: 57 P 57