BLASTX nr result
ID: Papaver31_contig00010640
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00010640 (593 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004297911.1| PREDICTED: putative F-box protein At3g52320 ... 58 4e-06 >ref|XP_004297911.1| PREDICTED: putative F-box protein At3g52320 [Fragaria vesca subsp. vesca] Length = 358 Score = 57.8 bits (138), Expect = 4e-06 Identities = 41/124 (33%), Positives = 61/124 (49%), Gaps = 4/124 (3%) Frame = +1 Query: 133 YHFGFDPEKKEHKVFCFWRLSARYPGYRGGSFKRPDYARWEVLTLGRDTKWRKINMVPND 312 YHFGF+P E+KV RLS + G +K + TLG + WR+I Sbjct: 134 YHFGFNPLADEYKVLQVQRLSCK--GEHSWVYK--------IFTLGASS-WRRIE----- 177 Query: 313 NNKTIINEVLSPYDSGK----QPLYADGTLYWRNKVRYPGLWGDPDVIVALDVGSEKFRV 480 + + + L+P+DS + +YADG +YW + DVI+ + G EKFRV Sbjct: 178 --EDLDVDRLAPFDSSNSYFCKGVYADGVMYWLTR----------DVILTFEFGDEKFRV 225 Query: 481 IPIP 492 +P+P Sbjct: 226 MPLP 229