BLASTX nr result
ID: Papaver31_contig00009981
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00009981 (510 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009784240.1| PREDICTED: FACT complex subunit SPT16-like [... 60 8e-07 ref|XP_004230348.1| PREDICTED: FACT complex subunit SPT16-like [... 60 8e-07 ref|XP_006358555.1| PREDICTED: FACT complex subunit SPT16-like i... 59 1e-06 gb|KDO45368.1| hypothetical protein CISIN_1g001503mg [Citrus sin... 57 1e-06 ref|XP_006428261.1| hypothetical protein CICLE_v10010953mg [Citr... 57 1e-06 gb|KDO45367.1| hypothetical protein CISIN_1g001503mg [Citrus sin... 57 1e-06 ref|XP_009629185.1| PREDICTED: FACT complex subunit SPT16-like [... 59 2e-06 gb|EIE81524.1| hypothetical protein RO3G_06229 [Rhizopus delemar... 59 2e-06 ref|XP_012434306.1| PREDICTED: FACT complex subunit SPT16-like i... 58 3e-06 ref|XP_012434304.1| PREDICTED: FACT complex subunit SPT16-like i... 58 3e-06 gb|KHG02937.1| FACT complex subunit SPT16 -like protein [Gossypi... 58 3e-06 ref|XP_002512565.1| FACT complex subunit SPT16, putative [Ricinu... 58 3e-06 ref|XP_006428260.1| hypothetical protein CICLE_v10010951mg [Citr... 57 3e-06 ref|XP_009771017.1| PREDICTED: FACT complex subunit SPT16-like, ... 57 4e-06 ref|XP_009629186.1| PREDICTED: FACT complex subunit SPT16-like [... 57 4e-06 ref|XP_012088842.1| PREDICTED: FACT complex subunit SPT16-like [... 57 4e-06 ref|XP_012462249.1| PREDICTED: FACT complex subunit SPT16-like [... 57 5e-06 ref|XP_012462246.1| PREDICTED: FACT complex subunit SPT16-like [... 57 5e-06 gb|KHG08754.1| FACT complex subunit SPT16 -like protein [Gossypi... 57 5e-06 gb|KDO45365.1| hypothetical protein CISIN_1g001468mg [Citrus sin... 57 5e-06 >ref|XP_009784240.1| PREDICTED: FACT complex subunit SPT16-like [Nicotiana sylvestris] gi|698472338|ref|XP_009784241.1| PREDICTED: FACT complex subunit SPT16-like [Nicotiana sylvestris] Length = 1063 Score = 59.7 bits (143), Expect = 8e-07 Identities = 35/90 (38%), Positives = 48/90 (53%), Gaps = 7/90 (7%) Frame = -3 Query: 436 KDFKCDPVRINSIPLDSLNLIKDRFKFSKVKYFEDCKDLNWDSIVKEREDSPGKFYANKG 257 KDFK D +RI+SIP+ SL+ IK+ + +KY+E +LNW ++K D P KF + G Sbjct: 889 KDFKRDVMRIDSIPISSLDGIKEWLDTTDIKYYESKVNLNWRQVLKTITDEPQKFIDDGG 948 Query: 256 WFLYGL-------GDLATASLYEHYYAVPE 188 W L GD + YE A PE Sbjct: 949 WEFLNLEGTDSSSGDSESDQGYEPSDAEPE 978 >ref|XP_004230348.1| PREDICTED: FACT complex subunit SPT16-like [Solanum lycopersicum] gi|723663340|ref|XP_010313805.1| PREDICTED: FACT complex subunit SPT16-like [Solanum lycopersicum] Length = 1054 Score = 59.7 bits (143), Expect = 8e-07 Identities = 35/90 (38%), Positives = 48/90 (53%), Gaps = 7/90 (7%) Frame = -3 Query: 436 KDFKCDPVRINSIPLDSLNLIKDRFKFSKVKYFEDCKDLNWDSIVKEREDSPGKFYANKG 257 KDFK D +RI+SIP+ SL+ IK+ + +KY+E +LNW ++K D P KF + G Sbjct: 882 KDFKRDVMRIDSIPISSLDGIKEWLDTTDIKYYESKVNLNWRQVLKTITDEPQKFIDDGG 941 Query: 256 WFLYGL-------GDLATASLYEHYYAVPE 188 W L GD + YE A PE Sbjct: 942 WEFLNLEGTDSSSGDSESDQGYEPSDAEPE 971 >ref|XP_006358555.1| PREDICTED: FACT complex subunit SPT16-like isoform X1 [Solanum tuberosum] gi|565385315|ref|XP_006358556.1| PREDICTED: FACT complex subunit SPT16-like isoform X2 [Solanum tuberosum] Length = 1051 Score = 59.3 bits (142), Expect = 1e-06 Identities = 35/90 (38%), Positives = 47/90 (52%), Gaps = 7/90 (7%) Frame = -3 Query: 436 KDFKCDPVRINSIPLDSLNLIKDRFKFSKVKYFEDCKDLNWDSIVKEREDSPGKFYANKG 257 KDFK D +RI+SIP+ SL+ IK+ + +KY+E +LNW ++K D P KF G Sbjct: 879 KDFKRDVMRIDSIPISSLDGIKEWLDTTDIKYYESKVNLNWRQVLKTITDEPQKFIDEGG 938 Query: 256 WFLYGL-------GDLATASLYEHYYAVPE 188 W L GD + YE A PE Sbjct: 939 WEFLNLEGTDSSSGDSESDQGYEPSDAEPE 968 >gb|KDO45368.1| hypothetical protein CISIN_1g001503mg [Citrus sinensis] Length = 1065 Score = 56.6 bits (135), Expect(2) = 1e-06 Identities = 29/68 (42%), Positives = 39/68 (57%) Frame = -3 Query: 457 FQGNIPSKDFKCDPVRINSIPLDSLNLIKDRFKFSKVKYFEDCKDLNWDSIVKEREDSPG 278 F I KDFK D +RI+SIP SL+ IK+ + +KY+E +LNW I+K D P Sbjct: 882 FDMTIVFKDFKKDVLRIDSIPSSSLDSIKEWLDTTDIKYYESRLNLNWRQILKTITDDPQ 941 Query: 277 KFYANKGW 254 F + GW Sbjct: 942 SFIDDGGW 949 Score = 22.3 bits (46), Expect(2) = 1e-06 Identities = 14/43 (32%), Positives = 22/43 (51%) Frame = -1 Query: 222 QAYTNTTMQYLK*TTMQNMGN*SMNESEDEGEEVTHWRSERSR 94 Q Y + M+ T ++ + S+ ESEDE EE + SE + Sbjct: 969 QGYEPSDMEVDSVTEDEDSDSESLVESEDEEEEDSEEDSEEEK 1011 >ref|XP_006428261.1| hypothetical protein CICLE_v10010953mg [Citrus clementina] gi|568853289|ref|XP_006480296.1| PREDICTED: FACT complex subunit SPT16-like [Citrus sinensis] gi|557530318|gb|ESR41501.1| hypothetical protein CICLE_v10010953mg [Citrus clementina] Length = 1065 Score = 56.6 bits (135), Expect(2) = 1e-06 Identities = 29/68 (42%), Positives = 39/68 (57%) Frame = -3 Query: 457 FQGNIPSKDFKCDPVRINSIPLDSLNLIKDRFKFSKVKYFEDCKDLNWDSIVKEREDSPG 278 F I KDFK D +RI+SIP SL+ IK+ + +KY+E +LNW I+K D P Sbjct: 882 FDMTIVFKDFKKDVLRIDSIPSSSLDSIKEWLDTTDIKYYESRLNLNWRQILKTITDDPQ 941 Query: 277 KFYANKGW 254 F + GW Sbjct: 942 SFIDDGGW 949 Score = 22.3 bits (46), Expect(2) = 1e-06 Identities = 14/43 (32%), Positives = 22/43 (51%) Frame = -1 Query: 222 QAYTNTTMQYLK*TTMQNMGN*SMNESEDEGEEVTHWRSERSR 94 Q Y + M+ T ++ + S+ ESEDE EE + SE + Sbjct: 969 QGYEPSDMEVDSVTEDEDSDSESLVESEDEEEEDSEEDSEEEK 1011 >gb|KDO45367.1| hypothetical protein CISIN_1g001503mg [Citrus sinensis] Length = 825 Score = 56.6 bits (135), Expect(2) = 1e-06 Identities = 29/68 (42%), Positives = 39/68 (57%) Frame = -3 Query: 457 FQGNIPSKDFKCDPVRINSIPLDSLNLIKDRFKFSKVKYFEDCKDLNWDSIVKEREDSPG 278 F I KDFK D +RI+SIP SL+ IK+ + +KY+E +LNW I+K D P Sbjct: 642 FDMTIVFKDFKKDVLRIDSIPSSSLDSIKEWLDTTDIKYYESRLNLNWRQILKTITDDPQ 701 Query: 277 KFYANKGW 254 F + GW Sbjct: 702 SFIDDGGW 709 Score = 22.3 bits (46), Expect(2) = 1e-06 Identities = 14/43 (32%), Positives = 22/43 (51%) Frame = -1 Query: 222 QAYTNTTMQYLK*TTMQNMGN*SMNESEDEGEEVTHWRSERSR 94 Q Y + M+ T ++ + S+ ESEDE EE + SE + Sbjct: 729 QGYEPSDMEVDSVTEDEDSDSESLVESEDEEEEDSEEDSEEEK 771 >ref|XP_009629185.1| PREDICTED: FACT complex subunit SPT16-like [Nicotiana tomentosiformis] Length = 1063 Score = 58.5 bits (140), Expect = 2e-06 Identities = 34/90 (37%), Positives = 48/90 (53%), Gaps = 7/90 (7%) Frame = -3 Query: 436 KDFKCDPVRINSIPLDSLNLIKDRFKFSKVKYFEDCKDLNWDSIVKEREDSPGKFYANKG 257 KDFK D +RI+SIP+ SL+ IK+ + +KY+E +LNW ++K D P +F + G Sbjct: 889 KDFKRDVMRIDSIPISSLDGIKEWLDTTDIKYYESKVNLNWRQVLKTITDEPQRFIDDGG 948 Query: 256 WFLYGL-------GDLATASLYEHYYAVPE 188 W L GD + YE A PE Sbjct: 949 WEFLNLEGTDSSSGDSESDQGYEPSDAEPE 978 >gb|EIE81524.1| hypothetical protein RO3G_06229 [Rhizopus delemar RA 99-880] Length = 1015 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/67 (40%), Positives = 37/67 (55%) Frame = -3 Query: 436 KDFKCDPVRINSIPLDSLNLIKDRFKFSKVKYFEDCKDLNWDSIVKEREDSPGKFYANKG 257 KDF PV IN+IP+ L+ +KD +V + E +LNW I+K D P F+ N G Sbjct: 863 KDFNRTPVHINTIPMSQLDNVKDWLDSVEVAFIEGTVNLNWSMIMKTVNDDPADFFKNGG 922 Query: 256 WFLYGLG 236 W + G G Sbjct: 923 WSVLGSG 929 >ref|XP_012434306.1| PREDICTED: FACT complex subunit SPT16-like isoform X2 [Gossypium raimondii] Length = 1054 Score = 57.8 bits (138), Expect = 3e-06 Identities = 30/68 (44%), Positives = 39/68 (57%) Frame = -3 Query: 457 FQGNIPSKDFKCDPVRINSIPLDSLNLIKDRFKFSKVKYFEDCKDLNWDSIVKEREDSPG 278 F I KDFK D +RI+SIP SL+ IK+ + +KY+E +LNW I+K D P Sbjct: 871 FDMTIVFKDFKKDVLRIDSIPSTSLDGIKEWLDTTDIKYYESRLNLNWRQILKTITDDPQ 930 Query: 277 KFYANKGW 254 F N GW Sbjct: 931 SFIENGGW 938 >ref|XP_012434304.1| PREDICTED: FACT complex subunit SPT16-like isoform X1 [Gossypium raimondii] gi|823197518|ref|XP_012434305.1| PREDICTED: FACT complex subunit SPT16-like isoform X1 [Gossypium raimondii] gi|763778362|gb|KJB45485.1| hypothetical protein B456_007G308600 [Gossypium raimondii] Length = 1065 Score = 57.8 bits (138), Expect = 3e-06 Identities = 30/68 (44%), Positives = 39/68 (57%) Frame = -3 Query: 457 FQGNIPSKDFKCDPVRINSIPLDSLNLIKDRFKFSKVKYFEDCKDLNWDSIVKEREDSPG 278 F I KDFK D +RI+SIP SL+ IK+ + +KY+E +LNW I+K D P Sbjct: 882 FDMTIVFKDFKKDVLRIDSIPSTSLDGIKEWLDTTDIKYYESRLNLNWRQILKTITDDPQ 941 Query: 277 KFYANKGW 254 F N GW Sbjct: 942 SFIENGGW 949 >gb|KHG02937.1| FACT complex subunit SPT16 -like protein [Gossypium arboreum] gi|728842869|gb|KHG22312.1| FACT complex subunit SPT16 -like protein [Gossypium arboreum] Length = 1065 Score = 57.8 bits (138), Expect = 3e-06 Identities = 30/68 (44%), Positives = 39/68 (57%) Frame = -3 Query: 457 FQGNIPSKDFKCDPVRINSIPLDSLNLIKDRFKFSKVKYFEDCKDLNWDSIVKEREDSPG 278 F I KDFK D +RI+SIP SL+ IK+ + +KY+E +LNW I+K D P Sbjct: 882 FDMTIVFKDFKKDVLRIDSIPSTSLDGIKEWLDTTDIKYYESRLNLNWRQILKTITDDPQ 941 Query: 277 KFYANKGW 254 F N GW Sbjct: 942 SFIENGGW 949 >ref|XP_002512565.1| FACT complex subunit SPT16, putative [Ricinus communis] gi|223548526|gb|EEF50017.1| FACT complex subunit SPT16, putative [Ricinus communis] Length = 1098 Score = 57.8 bits (138), Expect = 3e-06 Identities = 30/68 (44%), Positives = 40/68 (58%) Frame = -3 Query: 457 FQGNIPSKDFKCDPVRINSIPLDSLNLIKDRFKFSKVKYFEDCKDLNWDSIVKEREDSPG 278 F I KDFK D +RI+SIP SL+ IK+ + +KY+E +LNW I+K D P Sbjct: 881 FDMTIVFKDFKRDVLRIDSIPSTSLDSIKEWLNTTDLKYYESRLNLNWRPILKTITDDPE 940 Query: 277 KFYANKGW 254 KF + GW Sbjct: 941 KFIEDGGW 948 >ref|XP_006428260.1| hypothetical protein CICLE_v10010951mg [Citrus clementina] gi|568853285|ref|XP_006480294.1| PREDICTED: FACT complex subunit SPT16-like isoform X1 [Citrus sinensis] gi|568853287|ref|XP_006480295.1| PREDICTED: FACT complex subunit SPT16-like isoform X2 [Citrus sinensis] gi|557530317|gb|ESR41500.1| hypothetical protein CICLE_v10010951mg [Citrus clementina] Length = 1073 Score = 57.0 bits (136), Expect(2) = 3e-06 Identities = 30/68 (44%), Positives = 40/68 (58%) Frame = -3 Query: 457 FQGNIPSKDFKCDPVRINSIPLDSLNLIKDRFKFSKVKYFEDCKDLNWDSIVKEREDSPG 278 F I KDFK D +RI+SIP SL+ IK+ + +KY+E +LNW I+K D P Sbjct: 886 FDMTIVFKDFKRDVLRIDSIPSSSLDGIKEWLDTTDLKYYESRLNLNWRPILKTITDDPE 945 Query: 277 KFYANKGW 254 KF + GW Sbjct: 946 KFIEDGGW 953 Score = 20.4 bits (41), Expect(2) = 3e-06 Identities = 14/46 (30%), Positives = 23/46 (50%) Frame = -1 Query: 222 QAYTNTTMQYLK*TTMQNMGN*SMNESEDEGEEVTHWRSERSREPS 85 Q Y + +Q + +N + S+ ESED+ EE + SE + S Sbjct: 973 QGYEPSDVQSDSVSDDENDDSESLVESEDDEEEDSEEDSEEDKGKS 1018 >ref|XP_009771017.1| PREDICTED: FACT complex subunit SPT16-like, partial [Nicotiana sylvestris] Length = 1057 Score = 57.4 bits (137), Expect = 4e-06 Identities = 30/68 (44%), Positives = 40/68 (58%) Frame = -3 Query: 457 FQGNIPSKDFKCDPVRINSIPLDSLNLIKDRFKFSKVKYFEDCKDLNWDSIVKEREDSPG 278 F I KDFK D +RI+SIP SL+ IK+ + +KY+E +LNW I+K D P Sbjct: 885 FDMTIVFKDFKRDVMRIDSIPSTSLDGIKEWLDTTDLKYYESRLNLNWRQILKTITDDPE 944 Query: 277 KFYANKGW 254 +F N GW Sbjct: 945 EFIENGGW 952 >ref|XP_009629186.1| PREDICTED: FACT complex subunit SPT16-like [Nicotiana tomentosiformis] gi|697149958|ref|XP_009629187.1| PREDICTED: FACT complex subunit SPT16-like [Nicotiana tomentosiformis] Length = 1070 Score = 57.4 bits (137), Expect = 4e-06 Identities = 30/68 (44%), Positives = 40/68 (58%) Frame = -3 Query: 457 FQGNIPSKDFKCDPVRINSIPLDSLNLIKDRFKFSKVKYFEDCKDLNWDSIVKEREDSPG 278 F I KDFK D +RI+SIP SL+ IK+ + +KY+E +LNW I+K D P Sbjct: 885 FDMTIVFKDFKRDVMRIDSIPSTSLDGIKEWLDTTDLKYYESRLNLNWRQILKTITDDPE 944 Query: 277 KFYANKGW 254 +F N GW Sbjct: 945 EFIENGGW 952 >ref|XP_012088842.1| PREDICTED: FACT complex subunit SPT16-like [Jatropha curcas] gi|643708432|gb|KDP23348.1| hypothetical protein JCGZ_23181 [Jatropha curcas] Length = 1076 Score = 57.4 bits (137), Expect = 4e-06 Identities = 30/68 (44%), Positives = 40/68 (58%) Frame = -3 Query: 457 FQGNIPSKDFKCDPVRINSIPLDSLNLIKDRFKFSKVKYFEDCKDLNWDSIVKEREDSPG 278 F I KDFK D +RI+SIP SL+ IK+ + +KY+E +LNW I+K D P Sbjct: 884 FDMTIVFKDFKRDVLRIDSIPSTSLDNIKEWLNTTDLKYYESRLNLNWRPILKTITDDPE 943 Query: 277 KFYANKGW 254 KF + GW Sbjct: 944 KFIEDGGW 951 >ref|XP_012462249.1| PREDICTED: FACT complex subunit SPT16-like [Gossypium raimondii] gi|823259096|ref|XP_012462250.1| PREDICTED: FACT complex subunit SPT16-like [Gossypium raimondii] gi|763815833|gb|KJB82685.1| hypothetical protein B456_013G209300 [Gossypium raimondii] Length = 1064 Score = 57.0 bits (136), Expect = 5e-06 Identities = 30/68 (44%), Positives = 39/68 (57%) Frame = -3 Query: 457 FQGNIPSKDFKCDPVRINSIPLDSLNLIKDRFKFSKVKYFEDCKDLNWDSIVKEREDSPG 278 F I KDFK D +RI+SIP SL+ IK+ + +KY+E +LNW I+K D P Sbjct: 881 FDMTIVFKDFKRDVLRIDSIPSTSLDGIKEWLDTTDLKYYESRLNLNWRQILKTITDDPQ 940 Query: 277 KFYANKGW 254 F N GW Sbjct: 941 SFIENGGW 948 >ref|XP_012462246.1| PREDICTED: FACT complex subunit SPT16-like [Gossypium raimondii] gi|823259090|ref|XP_012462247.1| PREDICTED: FACT complex subunit SPT16-like [Gossypium raimondii] gi|823259092|ref|XP_012462248.1| PREDICTED: FACT complex subunit SPT16-like [Gossypium raimondii] gi|763815832|gb|KJB82684.1| hypothetical protein B456_013G209200 [Gossypium raimondii] Length = 1070 Score = 57.0 bits (136), Expect = 5e-06 Identities = 30/68 (44%), Positives = 40/68 (58%) Frame = -3 Query: 457 FQGNIPSKDFKCDPVRINSIPLDSLNLIKDRFKFSKVKYFEDCKDLNWDSIVKEREDSPG 278 F I KDFK D +RI+SIP SL+ IK+ + +KY+E +LNW I+K D P Sbjct: 884 FDMTIVFKDFKRDVLRIDSIPSTSLDGIKEWLNTTDLKYYESRLNLNWRPILKTITDDPE 943 Query: 277 KFYANKGW 254 KF + GW Sbjct: 944 KFIEDGGW 951 >gb|KHG08754.1| FACT complex subunit SPT16 -like protein [Gossypium arboreum] Length = 1064 Score = 57.0 bits (136), Expect = 5e-06 Identities = 30/68 (44%), Positives = 39/68 (57%) Frame = -3 Query: 457 FQGNIPSKDFKCDPVRINSIPLDSLNLIKDRFKFSKVKYFEDCKDLNWDSIVKEREDSPG 278 F I KDFK D +RI+SIP SL+ IK+ + +KY+E +LNW I+K D P Sbjct: 881 FDMTIVFKDFKRDVLRIDSIPSTSLDGIKEWLDTTDLKYYESRLNLNWRQILKTITDDPQ 940 Query: 277 KFYANKGW 254 F N GW Sbjct: 941 SFIENGGW 948 >gb|KDO45365.1| hypothetical protein CISIN_1g001468mg [Citrus sinensis] gi|641826126|gb|KDO45366.1| hypothetical protein CISIN_1g001468mg [Citrus sinensis] Length = 1073 Score = 57.0 bits (136), Expect = 5e-06 Identities = 30/68 (44%), Positives = 40/68 (58%) Frame = -3 Query: 457 FQGNIPSKDFKCDPVRINSIPLDSLNLIKDRFKFSKVKYFEDCKDLNWDSIVKEREDSPG 278 F I KDFK D +RI+SIP SL+ IK+ + +KY+E +LNW I+K D P Sbjct: 886 FDMTIVFKDFKRDVLRIDSIPSSSLDGIKEWLDTTDLKYYESRLNLNWRPILKTITDDPE 945 Query: 277 KFYANKGW 254 KF + GW Sbjct: 946 KFIEDGGW 953