BLASTX nr result
ID: Papaver31_contig00009533
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00009533 (494 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010257409.1| PREDICTED: thioredoxin-like protein Clot [Ne... 113 6e-23 ref|XP_006338899.1| PREDICTED: thioredoxin-like protein Clot-lik... 110 4e-22 ref|XP_009354687.1| PREDICTED: thioredoxin-like protein Clot [Py... 110 5e-22 ref|XP_002513195.1| electron transporter, putative [Ricinus comm... 109 7e-22 ref|XP_002265835.1| PREDICTED: thioredoxin-like protein Clot [Vi... 109 9e-22 ref|XP_011651794.1| PREDICTED: thioredoxin-like protein Clot iso... 108 2e-21 ref|XP_008375139.1| PREDICTED: thioredoxin-like protein Clot [Ma... 108 2e-21 ref|XP_012065509.1| PREDICTED: thioredoxin-like protein Clot [Ja... 108 2e-21 ref|XP_010327286.1| PREDICTED: thioredoxin-like protein Clot [So... 107 3e-21 ref|XP_009798568.1| PREDICTED: thioredoxin-like protein Clot [Ni... 107 3e-21 ref|XP_007052588.1| Thioredoxin superfamily protein isoform 1 [T... 107 3e-21 ref|XP_010095387.1| hypothetical protein L484_013059 [Morus nota... 107 3e-21 ref|XP_011093375.1| PREDICTED: thioredoxin-like protein Clot [Se... 107 3e-21 gb|ADR70871.1| thioredoxin-like family protein [Hevea brasiliensis] 107 3e-21 ref|XP_004306505.1| PREDICTED: thioredoxin-like protein Clot [Fr... 107 5e-21 ref|XP_014500437.1| PREDICTED: thioredoxin-like protein Clot [Vi... 106 6e-21 ref|XP_012485176.1| PREDICTED: thioredoxin-like protein Clot [Go... 106 6e-21 ref|XP_014501338.1| PREDICTED: thioredoxin-like protein Clot [Vi... 106 8e-21 gb|KOM42866.1| hypothetical protein LR48_Vigan05g047000 [Vigna a... 106 8e-21 ref|XP_008461777.1| PREDICTED: thioredoxin-like protein Clot iso... 106 8e-21 >ref|XP_010257409.1| PREDICTED: thioredoxin-like protein Clot [Nelumbo nucifera] Length = 179 Score = 113 bits (282), Expect = 6e-23 Identities = 62/118 (52%), Positives = 81/118 (68%), Gaps = 4/118 (3%) Frame = -1 Query: 344 VKLALYLLIFVCISERLLRLGFVNREEQIPV--SLPRKHLRKMPLKMVDVTPSHFDQAFE 171 V L L+ L+++ + F++RE + S P +RKM L M+D T S FDQ FE Sbjct: 9 VSLFLFFLLYLINYSTFV---FLSREPEYQTQNSFPSTLVRKMHLNMLDATLSSFDQVFE 65 Query: 170 KFNSE--NGRIKFILFLADIDPSTSVSWCPDCVRAEPVIYKKLEESSSDVLLLRAYVG 3 +F S+ ++ ILFLAD DPSTS+SWCPDCVRAEPVIYKKLE S++DV+LLRA+VG Sbjct: 66 RFKSDAPKHQVNLILFLADKDPSTSLSWCPDCVRAEPVIYKKLEASATDVVLLRAFVG 123 >ref|XP_006338899.1| PREDICTED: thioredoxin-like protein Clot-like [Solanum tuberosum] Length = 132 Score = 110 bits (275), Expect = 4e-22 Identities = 54/76 (71%), Positives = 63/76 (82%), Gaps = 2/76 (2%) Frame = -1 Query: 224 MPLKMVDVTPSHFDQAFEKFNSENGRIK--FILFLADIDPSTSVSWCPDCVRAEPVIYKK 51 MPLK++D T + FD FEKF +E+ + K FILFLADIDPST++SWCPDCVRAEPVIYKK Sbjct: 1 MPLKVLDATVATFDGVFEKFRAESPKNKANFILFLADIDPSTNLSWCPDCVRAEPVIYKK 60 Query: 50 LEESSSDVLLLRAYVG 3 LE SS D+ LLRAYVG Sbjct: 61 LEASSDDIALLRAYVG 76 >ref|XP_009354687.1| PREDICTED: thioredoxin-like protein Clot [Pyrus x bretschneideri] Length = 132 Score = 110 bits (274), Expect = 5e-22 Identities = 55/76 (72%), Positives = 60/76 (78%), Gaps = 2/76 (2%) Frame = -1 Query: 224 MPLKMVDVTPSHFDQAFEKFNSE--NGRIKFILFLADIDPSTSVSWCPDCVRAEPVIYKK 51 MPLK+ D T S FD AFEKF +E N + FILFLAD DPSTS+SWCPDCVRAEPVIYKK Sbjct: 1 MPLKLSDATISTFDSAFEKFKAEAPNNKANFILFLADKDPSTSLSWCPDCVRAEPVIYKK 60 Query: 50 LEESSSDVLLLRAYVG 3 LE + DV LLRAYVG Sbjct: 61 LEATPDDVALLRAYVG 76 >ref|XP_002513195.1| electron transporter, putative [Ricinus communis] gi|223547693|gb|EEF49186.1| electron transporter, putative [Ricinus communis] Length = 132 Score = 109 bits (273), Expect = 7e-22 Identities = 56/76 (73%), Positives = 60/76 (78%), Gaps = 2/76 (2%) Frame = -1 Query: 224 MPLKMVDVTPSHFDQAFEKFNSENGRIK--FILFLADIDPSTSVSWCPDCVRAEPVIYKK 51 MPLK+VD T S FD FEKF SE + K ILFLAD DPST++SWCPDCVRAEPVIYKK Sbjct: 1 MPLKLVDATISTFDSVFEKFKSEAAKNKANLILFLADKDPSTNLSWCPDCVRAEPVIYKK 60 Query: 50 LEESSSDVLLLRAYVG 3 LE SS DV LLRAYVG Sbjct: 61 LEASSDDVTLLRAYVG 76 >ref|XP_002265835.1| PREDICTED: thioredoxin-like protein Clot [Vitis vinifera] gi|297736204|emb|CBI24842.3| unnamed protein product [Vitis vinifera] Length = 132 Score = 109 bits (272), Expect = 9e-22 Identities = 55/76 (72%), Positives = 59/76 (77%), Gaps = 2/76 (2%) Frame = -1 Query: 224 MPLKMVDVTPSHFDQAFEKFNSE--NGRIKFILFLADIDPSTSVSWCPDCVRAEPVIYKK 51 MPLKMVD T S F+ EKF SE + ILFLAD DPSTS+SWCPDCVRAEPVIYKK Sbjct: 1 MPLKMVDATVSTFEGVLEKFRSEAPKNKANLILFLADKDPSTSLSWCPDCVRAEPVIYKK 60 Query: 50 LEESSSDVLLLRAYVG 3 LEESS D+ LLRAYVG Sbjct: 61 LEESSDDIALLRAYVG 76 >ref|XP_011651794.1| PREDICTED: thioredoxin-like protein Clot isoform X2 [Cucumis sativus] gi|700203483|gb|KGN58616.1| hypothetical protein Csa_3G701560 [Cucumis sativus] Length = 133 Score = 108 bits (270), Expect = 2e-21 Identities = 54/76 (71%), Positives = 59/76 (77%), Gaps = 2/76 (2%) Frame = -1 Query: 224 MPLKMVDVTPSHFDQAFEKFNSE--NGRIKFILFLADIDPSTSVSWCPDCVRAEPVIYKK 51 MPLK+VD T S F F+KF SE N + FILFLAD DPSTS SWCPDCVRAEPVIYKK Sbjct: 1 MPLKVVDATVSDFSAVFDKFRSELPNNKANFILFLADKDPSTSRSWCPDCVRAEPVIYKK 60 Query: 50 LEESSSDVLLLRAYVG 3 LE +S D+ LLRAYVG Sbjct: 61 LEAASDDIALLRAYVG 76 >ref|XP_008375139.1| PREDICTED: thioredoxin-like protein Clot [Malus domestica] gi|658057830|ref|XP_008364705.1| PREDICTED: thioredoxin-like protein Clot [Malus domestica] Length = 132 Score = 108 bits (269), Expect = 2e-21 Identities = 54/76 (71%), Positives = 59/76 (77%), Gaps = 2/76 (2%) Frame = -1 Query: 224 MPLKMVDVTPSHFDQAFEKFNSE--NGRIKFILFLADIDPSTSVSWCPDCVRAEPVIYKK 51 MPLK+ D T S FD FEKF +E N + FILFLAD DPSTS+SWCPDCVRAEPVIYKK Sbjct: 1 MPLKJSDATISTFDSXFEKFKAEAPNNKANFILFLADKDPSTSLSWCPDCVRAEPVIYKK 60 Query: 50 LEESSSDVLLLRAYVG 3 LE + DV LLRAYVG Sbjct: 61 LEATPDDVALLRAYVG 76 >ref|XP_012065509.1| PREDICTED: thioredoxin-like protein Clot [Jatropha curcas] gi|643737314|gb|KDP43426.1| hypothetical protein JCGZ_16713 [Jatropha curcas] Length = 132 Score = 108 bits (269), Expect = 2e-21 Identities = 53/76 (69%), Positives = 59/76 (77%), Gaps = 2/76 (2%) Frame = -1 Query: 224 MPLKMVDVTPSHFDQAFEKFNSE--NGRIKFILFLADIDPSTSVSWCPDCVRAEPVIYKK 51 MPLK+VD T S+FD FE F SE + ILFLAD DPST++SWCPDCVRAEPVIYKK Sbjct: 1 MPLKLVDATVSNFDSVFEMFRSEAPKNKANLILFLADKDPSTNLSWCPDCVRAEPVIYKK 60 Query: 50 LEESSSDVLLLRAYVG 3 LE SS D+ LLRAYVG Sbjct: 61 LEASSDDIALLRAYVG 76 >ref|XP_010327286.1| PREDICTED: thioredoxin-like protein Clot [Solanum lycopersicum] Length = 132 Score = 107 bits (268), Expect = 3e-21 Identities = 53/76 (69%), Positives = 62/76 (81%), Gaps = 2/76 (2%) Frame = -1 Query: 224 MPLKMVDVTPSHFDQAFEKFNSENGRIK--FILFLADIDPSTSVSWCPDCVRAEPVIYKK 51 MPLK++D T + FD FEKF +E+ + K FILFLADIDPST++SWCPDCVRAEPVIYKK Sbjct: 1 MPLKVLDATITTFDGVFEKFKAESPKNKANFILFLADIDPSTNLSWCPDCVRAEPVIYKK 60 Query: 50 LEESSSDVLLLRAYVG 3 LE S D+ LLRAYVG Sbjct: 61 LEASYDDIALLRAYVG 76 >ref|XP_009798568.1| PREDICTED: thioredoxin-like protein Clot [Nicotiana sylvestris] Length = 132 Score = 107 bits (268), Expect = 3e-21 Identities = 51/76 (67%), Positives = 62/76 (81%), Gaps = 2/76 (2%) Frame = -1 Query: 224 MPLKMVDVTPSHFDQAFEKFNSE--NGRIKFILFLADIDPSTSVSWCPDCVRAEPVIYKK 51 MPLK++D T + F+ FEKF +E + FILFLADIDPST++SWCPDCVRAEPVIYKK Sbjct: 1 MPLKVLDATIATFNGVFEKFRAEAPQNKANFILFLADIDPSTNLSWCPDCVRAEPVIYKK 60 Query: 50 LEESSSDVLLLRAYVG 3 +EES+ D+ LLRAYVG Sbjct: 61 MEESAEDIALLRAYVG 76 >ref|XP_007052588.1| Thioredoxin superfamily protein isoform 1 [Theobroma cacao] gi|508704849|gb|EOX96745.1| Thioredoxin superfamily protein isoform 1 [Theobroma cacao] Length = 133 Score = 107 bits (268), Expect = 3e-21 Identities = 53/76 (69%), Positives = 59/76 (77%), Gaps = 2/76 (2%) Frame = -1 Query: 224 MPLKMVDVTPSHFDQAFEKFNSE--NGRIKFILFLADIDPSTSVSWCPDCVRAEPVIYKK 51 MP+K VD T S FD FEKF S+ N + ILFLAD DPSTS+SWCPDCVRAEPVIYKK Sbjct: 1 MPMKSVDATVSGFDSVFEKFRSDAPNNKANLILFLADKDPSTSLSWCPDCVRAEPVIYKK 60 Query: 50 LEESSSDVLLLRAYVG 3 LE S+ DV +LRAYVG Sbjct: 61 LEASADDVAVLRAYVG 76 >ref|XP_010095387.1| hypothetical protein L484_013059 [Morus notabilis] gi|587870659|gb|EXB59939.1| hypothetical protein L484_013059 [Morus notabilis] Length = 132 Score = 107 bits (267), Expect = 3e-21 Identities = 54/76 (71%), Positives = 62/76 (81%), Gaps = 2/76 (2%) Frame = -1 Query: 224 MPLKMVDVTPSHFDQAFEKFNSENGRIK--FILFLADIDPSTSVSWCPDCVRAEPVIYKK 51 MPLK++D T S+F+ FEKF SE+ + K ILFLAD DPSTS+SWCPDCVRAEPVIYKK Sbjct: 1 MPLKLLDATVSNFESIFEKFISESTKNKANLILFLADKDPSTSLSWCPDCVRAEPVIYKK 60 Query: 50 LEESSSDVLLLRAYVG 3 LE +S DV LLRAYVG Sbjct: 61 LEATSDDVALLRAYVG 76 >ref|XP_011093375.1| PREDICTED: thioredoxin-like protein Clot [Sesamum indicum] Length = 163 Score = 107 bits (267), Expect = 3e-21 Identities = 53/78 (67%), Positives = 61/78 (78%), Gaps = 2/78 (2%) Frame = -1 Query: 230 RKMPLKMVDVTPSHFDQAFEKFNSE--NGRIKFILFLADIDPSTSVSWCPDCVRAEPVIY 57 +KMP+K +D T S F+ FEKF SE N + FILFLAD DPST++SWCPDCVRAEPVIY Sbjct: 30 QKMPMKTLDATVSTFEGVFEKFRSEAANNKANFILFLADKDPSTNLSWCPDCVRAEPVIY 89 Query: 56 KKLEESSSDVLLLRAYVG 3 KKLE S +V LLRAYVG Sbjct: 90 KKLEASPDNVALLRAYVG 107 >gb|ADR70871.1| thioredoxin-like family protein [Hevea brasiliensis] Length = 132 Score = 107 bits (267), Expect = 3e-21 Identities = 53/76 (69%), Positives = 59/76 (77%), Gaps = 2/76 (2%) Frame = -1 Query: 224 MPLKMVDVTPSHFDQAFEKFNSE--NGRIKFILFLADIDPSTSVSWCPDCVRAEPVIYKK 51 MPLK++D T S FD FEKF SE + ILFLAD DPST++SWCPDCVRAEPVIYKK Sbjct: 1 MPLKLLDATVSTFDGVFEKFRSEAPKNKANLILFLADKDPSTNLSWCPDCVRAEPVIYKK 60 Query: 50 LEESSSDVLLLRAYVG 3 LE SS D+ LLRAYVG Sbjct: 61 LEASSDDIALLRAYVG 76 >ref|XP_004306505.1| PREDICTED: thioredoxin-like protein Clot [Fragaria vesca subsp. vesca] Length = 132 Score = 107 bits (266), Expect = 5e-21 Identities = 53/76 (69%), Positives = 58/76 (76%), Gaps = 2/76 (2%) Frame = -1 Query: 224 MPLKMVDVTPSHFDQAFEKFNSE--NGRIKFILFLADIDPSTSVSWCPDCVRAEPVIYKK 51 MPLK++D T S FD FEKF E + FILFLAD DPSTS+SWCPDCVRAEPVIYKK Sbjct: 1 MPLKVLDATISSFDSVFEKFREEAPKNKANFILFLADKDPSTSLSWCPDCVRAEPVIYKK 60 Query: 50 LEESSSDVLLLRAYVG 3 LE + DV LLRAYVG Sbjct: 61 LEAAPGDVALLRAYVG 76 >ref|XP_014500437.1| PREDICTED: thioredoxin-like protein Clot [Vigna radiata var. radiata] Length = 132 Score = 106 bits (265), Expect = 6e-21 Identities = 53/76 (69%), Positives = 60/76 (78%), Gaps = 2/76 (2%) Frame = -1 Query: 224 MPLKMVDVTPSHFDQAFEKFNSENGRIK--FILFLADIDPSTSVSWCPDCVRAEPVIYKK 51 MPLK+++ T S FD FEKF SE+ K ILFLAD DP+TS+SWCPDCVRAEPVIYKK Sbjct: 1 MPLKVLEATVSSFDGVFEKFRSESAENKANLILFLADKDPATSLSWCPDCVRAEPVIYKK 60 Query: 50 LEESSSDVLLLRAYVG 3 LE SS D+ LLRAYVG Sbjct: 61 LEASSEDIALLRAYVG 76 >ref|XP_012485176.1| PREDICTED: thioredoxin-like protein Clot [Gossypium raimondii] gi|763768249|gb|KJB35464.1| hypothetical protein B456_006G116100 [Gossypium raimondii] Length = 134 Score = 106 bits (265), Expect = 6e-21 Identities = 55/76 (72%), Positives = 59/76 (77%), Gaps = 2/76 (2%) Frame = -1 Query: 224 MPLKMVDVTPSHFDQAFEKFNSE--NGRIKFILFLADIDPSTSVSWCPDCVRAEPVIYKK 51 MPLK+VD T S F FEKF S+ N + FILFLAD DPSTS+SWCPDCVRAEPVIYKK Sbjct: 1 MPLKVVDSTVSSFGGMFEKFRSDAPNYKANFILFLADKDPSTSLSWCPDCVRAEPVIYKK 60 Query: 50 LEESSSDVLLLRAYVG 3 LE S DV LLRAYVG Sbjct: 61 LEASPEDVTLLRAYVG 76 >ref|XP_014501338.1| PREDICTED: thioredoxin-like protein Clot [Vigna radiata var. radiata] Length = 131 Score = 106 bits (264), Expect = 8e-21 Identities = 52/76 (68%), Positives = 59/76 (77%), Gaps = 2/76 (2%) Frame = -1 Query: 224 MPLKMVDVTPSHFDQAFEKFNSE--NGRIKFILFLADIDPSTSVSWCPDCVRAEPVIYKK 51 MPLK+++ T S FD FEKF SE + ILFLAD DP+TS+SWCPDCVRAEPVIYKK Sbjct: 1 MPLKLLEATVSSFDGVFEKFRSEAAENKANLILFLADKDPATSLSWCPDCVRAEPVIYKK 60 Query: 50 LEESSSDVLLLRAYVG 3 LE SS D+ LLRAYVG Sbjct: 61 LEASSDDIALLRAYVG 76 >gb|KOM42866.1| hypothetical protein LR48_Vigan05g047000 [Vigna angularis] Length = 131 Score = 106 bits (264), Expect = 8e-21 Identities = 52/76 (68%), Positives = 59/76 (77%), Gaps = 2/76 (2%) Frame = -1 Query: 224 MPLKMVDVTPSHFDQAFEKFNSE--NGRIKFILFLADIDPSTSVSWCPDCVRAEPVIYKK 51 MPLK+++ T S FD FEKF SE + ILFLAD DP+TS+SWCPDCVRAEPVIYKK Sbjct: 1 MPLKLLEATVSSFDGVFEKFRSEAAENKANLILFLADKDPATSLSWCPDCVRAEPVIYKK 60 Query: 50 LEESSSDVLLLRAYVG 3 LE SS D+ LLRAYVG Sbjct: 61 LEASSDDIALLRAYVG 76 >ref|XP_008461777.1| PREDICTED: thioredoxin-like protein Clot isoform X2 [Cucumis melo] Length = 133 Score = 106 bits (264), Expect = 8e-21 Identities = 53/76 (69%), Positives = 59/76 (77%), Gaps = 2/76 (2%) Frame = -1 Query: 224 MPLKMVDVTPSHFDQAFEKFNSE--NGRIKFILFLADIDPSTSVSWCPDCVRAEPVIYKK 51 MPLK+VD T S F+ F+KF S+ N + FILFLAD DPSTS SWCPDCVRAEPVIYKK Sbjct: 1 MPLKVVDATLSDFNAVFDKFRSQLPNNKANFILFLADKDPSTSRSWCPDCVRAEPVIYKK 60 Query: 50 LEESSSDVLLLRAYVG 3 LE +S D LLRAYVG Sbjct: 61 LEAASDDTALLRAYVG 76