BLASTX nr result
ID: Papaver31_contig00005988
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00005988 (723 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006597671.1| PREDICTED: fatty acid 2-hydroxylase 1-like i... 72 5e-10 ref|XP_009362196.1| PREDICTED: fatty acid 2-hydroxylase 1-like [... 71 6e-10 ref|XP_009353853.1| PREDICTED: fatty acid 2-hydroxylase 1-like [... 70 2e-09 ref|XP_008349164.1| PREDICTED: fatty acid 2-hydroxylase 1-like, ... 70 2e-09 ref|XP_008383372.1| PREDICTED: fatty acid 2-hydroxylase 1-like [... 70 2e-09 ref|XP_011039276.1| PREDICTED: fatty acid 2-hydroxylase 1-like i... 69 2e-09 ref|XP_011039275.1| PREDICTED: fatty acid 2-hydroxylase 1-like i... 69 2e-09 ref|XP_002300560.1| FATTY ACID HYDROXYLASE 1 family protein [Pop... 69 2e-09 ref|XP_011006013.1| PREDICTED: fatty acid 2-hydroxylase 1-like [... 69 3e-09 ref|XP_011037722.1| PREDICTED: fatty acid 2-hydroxylase 1-like [... 69 3e-09 gb|KRH11818.1| hypothetical protein GLYMA_15G132500 [Glycine max] 69 4e-09 gb|KRH11815.1| hypothetical protein GLYMA_15G132500 [Glycine max... 69 4e-09 gb|KHN14310.1| Fatty acid 2-hydroxylase [Glycine soja] 69 4e-09 emb|CDP12584.1| unnamed protein product [Coffea canephora] 69 4e-09 ref|XP_008225651.1| PREDICTED: fatty acid 2-hydroxylase 1-like [... 69 4e-09 ref|XP_006586858.1| PREDICTED: fatty acid 2-hydroxylase 1-like i... 69 4e-09 ref|XP_007147453.1| hypothetical protein PHAVU_006G125900g [Phas... 69 4e-09 ref|XP_007147452.1| hypothetical protein PHAVU_006G125900g [Phas... 69 4e-09 ref|XP_007211938.1| hypothetical protein PRUPE_ppa010767mg [Prun... 69 4e-09 ref|XP_003546279.1| PREDICTED: fatty acid 2-hydroxylase 1-like i... 69 4e-09 >ref|XP_006597671.1| PREDICTED: fatty acid 2-hydroxylase 1-like isoform X3 [Glycine max] gi|947062562|gb|KRH11823.1| hypothetical protein GLYMA_15G132500 [Glycine max] Length = 214 Score = 71.6 bits (174), Expect = 5e-10 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = -2 Query: 722 GGGLLGYVMYDCTHYYLHHGQPTKEVPKNLKVRTGKLIVIETF 594 GGGLLGYVMYDCTHYYLHHGQP EVP+NLK ++ K +++ F Sbjct: 169 GGGLLGYVMYDCTHYYLHHGQPRTEVPRNLKHKSLKRKIVDGF 211 >ref|XP_009362196.1| PREDICTED: fatty acid 2-hydroxylase 1-like [Pyrus x bretschneideri] gi|694367606|ref|XP_009362197.1| PREDICTED: fatty acid 2-hydroxylase 1-like [Pyrus x bretschneideri] Length = 237 Score = 71.2 bits (173), Expect = 6e-10 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -2 Query: 722 GGGLLGYVMYDCTHYYLHHGQPTKEVPKNLK 630 GGGLLGYVMYDCTHYYLHHGQPT EVP+NLK Sbjct: 168 GGGLLGYVMYDCTHYYLHHGQPTSEVPRNLK 198 >ref|XP_009353853.1| PREDICTED: fatty acid 2-hydroxylase 1-like [Pyrus x bretschneideri] gi|694325846|ref|XP_009353854.1| PREDICTED: fatty acid 2-hydroxylase 1-like [Pyrus x bretschneideri] Length = 237 Score = 69.7 bits (169), Expect = 2e-09 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -2 Query: 722 GGGLLGYVMYDCTHYYLHHGQPTKEVPKNLK 630 GGGLLGYVMYDCTHYYLHHGQP+ EVP+NLK Sbjct: 168 GGGLLGYVMYDCTHYYLHHGQPSSEVPRNLK 198 >ref|XP_008349164.1| PREDICTED: fatty acid 2-hydroxylase 1-like, partial [Malus domestica] Length = 194 Score = 69.7 bits (169), Expect = 2e-09 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -2 Query: 722 GGGLLGYVMYDCTHYYLHHGQPTKEVPKNLK 630 GGGLLGYVMYDCTHYYLHHGQP+ EVP+NLK Sbjct: 125 GGGLLGYVMYDCTHYYLHHGQPSSEVPRNLK 155 >ref|XP_008383372.1| PREDICTED: fatty acid 2-hydroxylase 1-like [Malus domestica] Length = 81 Score = 69.7 bits (169), Expect = 2e-09 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -2 Query: 722 GGGLLGYVMYDCTHYYLHHGQPTKEVPKNLK 630 GGGLLGYVMYDCTHYYLHHGQP+ EVP+NLK Sbjct: 12 GGGLLGYVMYDCTHYYLHHGQPSSEVPRNLK 42 >ref|XP_011039276.1| PREDICTED: fatty acid 2-hydroxylase 1-like isoform X2 [Populus euphratica] gi|743891192|ref|XP_011039277.1| PREDICTED: fatty acid 2-hydroxylase 1-like isoform X2 [Populus euphratica] gi|743891196|ref|XP_011039278.1| PREDICTED: fatty acid 2-hydroxylase 1-like isoform X2 [Populus euphratica] Length = 236 Score = 69.3 bits (168), Expect = 2e-09 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -2 Query: 722 GGGLLGYVMYDCTHYYLHHGQPTKEVPKNLK 630 GGGLLGYVMYDCTHYYLHHGQP +VPKNLK Sbjct: 168 GGGLLGYVMYDCTHYYLHHGQPANDVPKNLK 198 >ref|XP_011039275.1| PREDICTED: fatty acid 2-hydroxylase 1-like isoform X1 [Populus euphratica] Length = 258 Score = 69.3 bits (168), Expect = 2e-09 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -2 Query: 722 GGGLLGYVMYDCTHYYLHHGQPTKEVPKNLK 630 GGGLLGYVMYDCTHYYLHHGQP +VPKNLK Sbjct: 190 GGGLLGYVMYDCTHYYLHHGQPANDVPKNLK 220 >ref|XP_002300560.1| FATTY ACID HYDROXYLASE 1 family protein [Populus trichocarpa] gi|118482950|gb|ABK93387.1| unknown [Populus trichocarpa] gi|222847818|gb|EEE85365.1| FATTY ACID HYDROXYLASE 1 family protein [Populus trichocarpa] Length = 236 Score = 69.3 bits (168), Expect = 2e-09 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -2 Query: 722 GGGLLGYVMYDCTHYYLHHGQPTKEVPKNLK 630 GGGLLGYVMYDCTHYYLHHGQP +VPKNLK Sbjct: 168 GGGLLGYVMYDCTHYYLHHGQPANDVPKNLK 198 >ref|XP_011006013.1| PREDICTED: fatty acid 2-hydroxylase 1-like [Populus euphratica] Length = 268 Score = 68.9 bits (167), Expect = 3e-09 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -2 Query: 722 GGGLLGYVMYDCTHYYLHHGQPTKEVPKNLK 630 GGGLLGYV+YDCTHYYLHHGQP EVPKNLK Sbjct: 200 GGGLLGYVIYDCTHYYLHHGQPANEVPKNLK 230 >ref|XP_011037722.1| PREDICTED: fatty acid 2-hydroxylase 1-like [Populus euphratica] gi|743938417|ref|XP_011013632.1| PREDICTED: fatty acid 2-hydroxylase 1-like [Populus euphratica] Length = 236 Score = 68.9 bits (167), Expect = 3e-09 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -2 Query: 722 GGGLLGYVMYDCTHYYLHHGQPTKEVPKNLK 630 GGGLLGYV+YDCTHYYLHHGQP EVPKNLK Sbjct: 168 GGGLLGYVIYDCTHYYLHHGQPANEVPKNLK 198 >gb|KRH11818.1| hypothetical protein GLYMA_15G132500 [Glycine max] Length = 244 Score = 68.6 bits (166), Expect = 4e-09 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -2 Query: 722 GGGLLGYVMYDCTHYYLHHGQPTKEVPKNLK 630 GGGLLGYVMYDCTHYYLHHGQP EVP+NLK Sbjct: 169 GGGLLGYVMYDCTHYYLHHGQPRTEVPRNLK 199 >gb|KRH11815.1| hypothetical protein GLYMA_15G132500 [Glycine max] gi|947062555|gb|KRH11816.1| hypothetical protein GLYMA_15G132500 [Glycine max] gi|947062556|gb|KRH11817.1| hypothetical protein GLYMA_15G132500 [Glycine max] Length = 259 Score = 68.6 bits (166), Expect = 4e-09 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -2 Query: 722 GGGLLGYVMYDCTHYYLHHGQPTKEVPKNLK 630 GGGLLGYVMYDCTHYYLHHGQP EVP+NLK Sbjct: 191 GGGLLGYVMYDCTHYYLHHGQPRTEVPRNLK 221 >gb|KHN14310.1| Fatty acid 2-hydroxylase [Glycine soja] Length = 307 Score = 68.6 bits (166), Expect = 4e-09 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -2 Query: 722 GGGLLGYVMYDCTHYYLHHGQPTKEVPKNLK 630 GGGLLGYVMYDCTHYYLHHGQP EVP+NLK Sbjct: 239 GGGLLGYVMYDCTHYYLHHGQPRTEVPRNLK 269 >emb|CDP12584.1| unnamed protein product [Coffea canephora] Length = 237 Score = 68.6 bits (166), Expect = 4e-09 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -2 Query: 722 GGGLLGYVMYDCTHYYLHHGQPTKEVPKNLK 630 GGGLLGYVMYD THYYLHHGQPT EVPKNLK Sbjct: 168 GGGLLGYVMYDVTHYYLHHGQPTSEVPKNLK 198 >ref|XP_008225651.1| PREDICTED: fatty acid 2-hydroxylase 1-like [Prunus mume] gi|645238379|ref|XP_008225652.1| PREDICTED: fatty acid 2-hydroxylase 1-like [Prunus mume] Length = 237 Score = 68.6 bits (166), Expect = 4e-09 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -2 Query: 722 GGGLLGYVMYDCTHYYLHHGQPTKEVPKNLK 630 GGGLLGYVMYDCTHYYLHHGQP+ +VP+NLK Sbjct: 168 GGGLLGYVMYDCTHYYLHHGQPSSDVPRNLK 198 >ref|XP_006586858.1| PREDICTED: fatty acid 2-hydroxylase 1-like isoform X2 [Glycine max] Length = 161 Score = 68.6 bits (166), Expect = 4e-09 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -2 Query: 722 GGGLLGYVMYDCTHYYLHHGQPTKEVPKNLK 630 GGGLLGYVMYDCTHYYLHHGQP EVP+NLK Sbjct: 93 GGGLLGYVMYDCTHYYLHHGQPKTEVPRNLK 123 >ref|XP_007147453.1| hypothetical protein PHAVU_006G125900g [Phaseolus vulgaris] gi|593693866|ref|XP_007147454.1| hypothetical protein PHAVU_006G125900g [Phaseolus vulgaris] gi|561020676|gb|ESW19447.1| hypothetical protein PHAVU_006G125900g [Phaseolus vulgaris] gi|561020677|gb|ESW19448.1| hypothetical protein PHAVU_006G125900g [Phaseolus vulgaris] Length = 237 Score = 68.6 bits (166), Expect = 4e-09 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -2 Query: 722 GGGLLGYVMYDCTHYYLHHGQPTKEVPKNLK 630 GGGLLGYVMYDCTHYYLHHGQP EVP+NLK Sbjct: 168 GGGLLGYVMYDCTHYYLHHGQPKTEVPRNLK 198 >ref|XP_007147452.1| hypothetical protein PHAVU_006G125900g [Phaseolus vulgaris] gi|561020675|gb|ESW19446.1| hypothetical protein PHAVU_006G125900g [Phaseolus vulgaris] Length = 244 Score = 68.6 bits (166), Expect = 4e-09 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -2 Query: 722 GGGLLGYVMYDCTHYYLHHGQPTKEVPKNLK 630 GGGLLGYVMYDCTHYYLHHGQP EVP+NLK Sbjct: 175 GGGLLGYVMYDCTHYYLHHGQPKTEVPRNLK 205 >ref|XP_007211938.1| hypothetical protein PRUPE_ppa010767mg [Prunus persica] gi|595865372|ref|XP_007211939.1| hypothetical protein PRUPE_ppa010767mg [Prunus persica] gi|462407803|gb|EMJ13137.1| hypothetical protein PRUPE_ppa010767mg [Prunus persica] gi|462407804|gb|EMJ13138.1| hypothetical protein PRUPE_ppa010767mg [Prunus persica] Length = 237 Score = 68.6 bits (166), Expect = 4e-09 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -2 Query: 722 GGGLLGYVMYDCTHYYLHHGQPTKEVPKNLK 630 GGGLLGYVMYDCTHYYLHHGQP+ +VP+NLK Sbjct: 168 GGGLLGYVMYDCTHYYLHHGQPSSDVPRNLK 198 >ref|XP_003546279.1| PREDICTED: fatty acid 2-hydroxylase 1-like isoform X1 [Glycine max] gi|571518286|ref|XP_006597670.1| PREDICTED: fatty acid 2-hydroxylase 1-like isoform X2 [Glycine max] gi|947062558|gb|KRH11819.1| hypothetical protein GLYMA_15G132500 [Glycine max] gi|947062559|gb|KRH11820.1| hypothetical protein GLYMA_15G132500 [Glycine max] gi|947062560|gb|KRH11821.1| hypothetical protein GLYMA_15G132500 [Glycine max] gi|947062561|gb|KRH11822.1| hypothetical protein GLYMA_15G132500 [Glycine max] Length = 237 Score = 68.6 bits (166), Expect = 4e-09 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -2 Query: 722 GGGLLGYVMYDCTHYYLHHGQPTKEVPKNLK 630 GGGLLGYVMYDCTHYYLHHGQP EVP+NLK Sbjct: 169 GGGLLGYVMYDCTHYYLHHGQPRTEVPRNLK 199