BLASTX nr result
ID: Papaver30_contig00062351
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00062351 (459 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519672.1| conserved hypothetical protein [Ricinus comm... 58 3e-06 >ref|XP_002519672.1| conserved hypothetical protein [Ricinus communis] gi|223541089|gb|EEF42645.1| conserved hypothetical protein [Ricinus communis] Length = 104 Score = 57.8 bits (138), Expect = 3e-06 Identities = 29/87 (33%), Positives = 46/87 (52%) Frame = -1 Query: 309 FELDSKLIVDAIRKEDYNIDWRLHNLVKVIKNLFLIFRSWHCYYVQKEKNKLADILSKSS 130 FE DS ++V +I D I W + V IK+L L SW Y+ + N +A L+K + Sbjct: 17 FETDSLMLVQSIESSDVEIIWAIEADVLFIKSLLLFNSSWSILYISRIANSVAGWLAKQA 76 Query: 129 RVGKLNRVWLSEPPGSIKSLLEKEYNY 49 R+ W + PP ++ SLL +++ Y Sbjct: 77 RLNVCPVPWQTNPPVALLSLLSRDFYY 103