BLASTX nr result
ID: Papaver30_contig00061898
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00061898 (655 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010250858.1| PREDICTED: cysteine proteinase COT44 [Nelumb... 61 7e-07 >ref|XP_010250858.1| PREDICTED: cysteine proteinase COT44 [Nelumbo nucifera] Length = 395 Score = 60.8 bits (146), Expect = 7e-07 Identities = 26/54 (48%), Positives = 39/54 (72%) Frame = +1 Query: 487 FVFFSILCLIPHLPCTSSSEPNHAIVLEVTDEHVKSEKNLLTLYSKWLSIHRPN 648 FV F +LCL+P LP TS++ ++VL V DE ++SE + +LY +WL+IHRP+ Sbjct: 7 FVAFLLLCLLPLLPTTSAASHGDSVVLGVADEDIQSESAIFSLYRRWLAIHRPH 60