BLASTX nr result
ID: Papaver30_contig00061422
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00061422 (519 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008351012.1| PREDICTED: putative ribonuclease H protein A... 39 4e-06 >ref|XP_008351012.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica] Length = 685 Score = 38.9 bits (89), Expect(2) = 4e-06 Identities = 16/35 (45%), Positives = 22/35 (62%) Frame = -3 Query: 400 LPSLFIWKPVIPPKITFLMWSLVHNKLNTIDTLDR 296 LPS IWK +PPK+ L+W + K+NT D + R Sbjct: 511 LPSPQIWKAKVPPKVKVLVWLVALRKVNTCDQIQR 545 Score = 38.1 bits (87), Expect(2) = 4e-06 Identities = 18/42 (42%), Positives = 24/42 (57%), Gaps = 11/42 (26%) Frame = -1 Query: 279 CVLCGNVEESQNHLFLHYKIACKLWY-----------MPKGC 187 CVLC + EES NH+FLH + +LW+ +PKGC Sbjct: 557 CVLCKSGEESVNHVFLHCPYSIQLWWNLLKEVGAVWVIPKGC 598