BLASTX nr result
ID: Papaver30_contig00061316
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00061316 (513 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004298792.1| PREDICTED: probable serine/threonine-protein... 62 1e-09 ref|XP_012086904.1| PREDICTED: probable serine/threonine-protein... 60 2e-09 ref|XP_012439662.1| PREDICTED: probable serine/threonine-protein... 60 2e-09 ref|XP_012486695.1| PREDICTED: probable serine/threonine-protein... 60 2e-09 ref|XP_008238842.1| PREDICTED: probable serine/threonine-protein... 60 2e-09 ref|XP_007040220.1| Kinase protein with tetratricopeptide repeat... 60 2e-09 ref|XP_007209958.1| hypothetical protein PRUPE_ppa004862mg [Prun... 60 2e-09 ref|XP_012439666.1| PREDICTED: probable serine/threonine-protein... 60 2e-09 gb|KJB52104.1| hypothetical protein B456_008G246800 [Gossypium r... 60 2e-09 ref|XP_008238844.1| PREDICTED: probable serine/threonine-protein... 60 2e-09 ref|XP_008238845.1| PREDICTED: probable serine/threonine-protein... 60 2e-09 ref|XP_002509803.1| receptor protein kinase, putative [Ricinus c... 60 4e-09 ref|XP_007040223.1| Kinase protein with tetratricopeptide repeat... 59 5e-09 emb|CDP09742.1| unnamed protein product [Coffea canephora] 59 5e-09 ref|XP_012836282.1| PREDICTED: probable serine/threonine-protein... 60 5e-09 ref|XP_008437265.1| PREDICTED: probable serine/threonine-protein... 59 5e-09 ref|XP_004143908.1| PREDICTED: probable serine/threonine-protein... 59 5e-09 gb|EYU38349.1| hypothetical protein MIMGU_mgv1a009089mg [Erythra... 60 5e-09 gb|KOM26238.1| hypothetical protein LR48_Vigan238s007100 [Vigna ... 62 7e-09 ref|XP_014494516.1| PREDICTED: probable serine/threonine-protein... 62 7e-09 >ref|XP_004298792.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 [Fragaria vesca subsp. vesca] Length = 488 Score = 61.6 bits (148), Expect(2) = 1e-09 Identities = 29/37 (78%), Positives = 30/37 (81%) Frame = +2 Query: 47 EGNS*FSCFGMMKDSRDGNSYRTNLAFTPPESLRTRR 157 EGN SCFGMMK+SRDG SY TNLAFTPPE LRT R Sbjct: 191 EGNPRLSCFGMMKNSRDGKSYSTNLAFTPPEYLRTGR 227 Score = 27.7 bits (60), Expect(2) = 1e-09 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +1 Query: 1 HDLTAYRIVFDD 36 HDL AYRIVFDD Sbjct: 179 HDLNAYRIVFDD 190 >ref|XP_012086904.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 [Jatropha curcas] gi|802739806|ref|XP_012086905.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 [Jatropha curcas] gi|802739811|ref|XP_012086906.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 [Jatropha curcas] gi|643712009|gb|KDP25437.1| hypothetical protein JCGZ_20593 [Jatropha curcas] Length = 489 Score = 60.5 bits (145), Expect(2) = 2e-09 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = +2 Query: 47 EGNS*FSCFGMMKDSRDGNSYRTNLAFTPPESLRTRR 157 EGN SCFG+MK+SRDG SY TNLAFTPPE LRT R Sbjct: 193 EGNPRLSCFGLMKNSRDGKSYSTNLAFTPPEYLRTGR 229 Score = 27.7 bits (60), Expect(2) = 2e-09 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +1 Query: 1 HDLTAYRIVFDD 36 HDL AYRIVFDD Sbjct: 181 HDLNAYRIVFDD 192 >ref|XP_012439662.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 isoform X1 [Gossypium raimondii] gi|823213837|ref|XP_012439663.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 isoform X1 [Gossypium raimondii] gi|823213839|ref|XP_012439664.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 isoform X1 [Gossypium raimondii] gi|823213841|ref|XP_012439665.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 isoform X1 [Gossypium raimondii] gi|763785030|gb|KJB52101.1| hypothetical protein B456_008G246800 [Gossypium raimondii] gi|763785031|gb|KJB52102.1| hypothetical protein B456_008G246800 [Gossypium raimondii] gi|763785032|gb|KJB52103.1| hypothetical protein B456_008G246800 [Gossypium raimondii] gi|763785034|gb|KJB52105.1| hypothetical protein B456_008G246800 [Gossypium raimondii] Length = 488 Score = 60.5 bits (145), Expect(2) = 2e-09 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = +2 Query: 47 EGNS*FSCFGMMKDSRDGNSYRTNLAFTPPESLRTRR 157 EGN SCFG+MK+SRDG SY TNLAFTPPE LRT R Sbjct: 192 EGNPRLSCFGLMKNSRDGKSYSTNLAFTPPEYLRTGR 228 Score = 27.7 bits (60), Expect(2) = 2e-09 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +1 Query: 1 HDLTAYRIVFDD 36 HDL AYRIVFDD Sbjct: 180 HDLNAYRIVFDD 191 >ref|XP_012486695.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 [Gossypium raimondii] gi|763770330|gb|KJB37545.1| hypothetical protein B456_006G209500 [Gossypium raimondii] Length = 488 Score = 60.5 bits (145), Expect(2) = 2e-09 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = +2 Query: 47 EGNS*FSCFGMMKDSRDGNSYRTNLAFTPPESLRTRR 157 EGN SCFG+MK+SRDG SY TNLAFTPPE LRT R Sbjct: 192 EGNPRLSCFGLMKNSRDGKSYSTNLAFTPPEYLRTGR 228 Score = 27.7 bits (60), Expect(2) = 2e-09 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +1 Query: 1 HDLTAYRIVFDD 36 HDL AYRIVFDD Sbjct: 180 HDLNAYRIVFDD 191 >ref|XP_008238842.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 isoform X1 [Prunus mume] gi|645266937|ref|XP_008238843.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 isoform X1 [Prunus mume] Length = 488 Score = 60.5 bits (145), Expect(2) = 2e-09 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = +2 Query: 47 EGNS*FSCFGMMKDSRDGNSYRTNLAFTPPESLRTRR 157 +GN SCFGMMK+SRDG SY TNLAFTPPE LRT R Sbjct: 191 DGNPRLSCFGMMKNSRDGKSYSTNLAFTPPEYLRTGR 227 Score = 27.7 bits (60), Expect(2) = 2e-09 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +1 Query: 1 HDLTAYRIVFDD 36 HDL AYRIVFDD Sbjct: 179 HDLNAYRIVFDD 190 >ref|XP_007040220.1| Kinase protein with tetratricopeptide repeat domain isoform 1 [Theobroma cacao] gi|590678155|ref|XP_007040221.1| Kinase protein with tetratricopeptide repeat domain isoform 1 [Theobroma cacao] gi|590678159|ref|XP_007040222.1| Kinase protein with tetratricopeptide repeat domain isoform 1 [Theobroma cacao] gi|508777465|gb|EOY24721.1| Kinase protein with tetratricopeptide repeat domain isoform 1 [Theobroma cacao] gi|508777466|gb|EOY24722.1| Kinase protein with tetratricopeptide repeat domain isoform 1 [Theobroma cacao] gi|508777467|gb|EOY24723.1| Kinase protein with tetratricopeptide repeat domain isoform 1 [Theobroma cacao] Length = 488 Score = 60.5 bits (145), Expect(2) = 2e-09 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = +2 Query: 47 EGNS*FSCFGMMKDSRDGNSYRTNLAFTPPESLRTRR 157 EGN SCFG+MK+SRDG SY TNLAFTPPE LRT R Sbjct: 192 EGNPRLSCFGLMKNSRDGKSYSTNLAFTPPEYLRTGR 228 Score = 27.7 bits (60), Expect(2) = 2e-09 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +1 Query: 1 HDLTAYRIVFDD 36 HDL AYRIVFDD Sbjct: 180 HDLNAYRIVFDD 191 >ref|XP_007209958.1| hypothetical protein PRUPE_ppa004862mg [Prunus persica] gi|462405693|gb|EMJ11157.1| hypothetical protein PRUPE_ppa004862mg [Prunus persica] Length = 488 Score = 60.5 bits (145), Expect(2) = 2e-09 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = +2 Query: 47 EGNS*FSCFGMMKDSRDGNSYRTNLAFTPPESLRTRR 157 +GN SCFGMMK+SRDG SY TNLAFTPPE LRT R Sbjct: 191 DGNPRLSCFGMMKNSRDGKSYSTNLAFTPPEYLRTGR 227 Score = 27.7 bits (60), Expect(2) = 2e-09 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +1 Query: 1 HDLTAYRIVFDD 36 HDL AYRIVFDD Sbjct: 179 HDLNAYRIVFDD 190 >ref|XP_012439666.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 isoform X2 [Gossypium raimondii] Length = 435 Score = 60.5 bits (145), Expect(2) = 2e-09 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = +2 Query: 47 EGNS*FSCFGMMKDSRDGNSYRTNLAFTPPESLRTRR 157 EGN SCFG+MK+SRDG SY TNLAFTPPE LRT R Sbjct: 192 EGNPRLSCFGLMKNSRDGKSYSTNLAFTPPEYLRTGR 228 Score = 27.7 bits (60), Expect(2) = 2e-09 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +1 Query: 1 HDLTAYRIVFDD 36 HDL AYRIVFDD Sbjct: 180 HDLNAYRIVFDD 191 >gb|KJB52104.1| hypothetical protein B456_008G246800 [Gossypium raimondii] Length = 421 Score = 60.5 bits (145), Expect(2) = 2e-09 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = +2 Query: 47 EGNS*FSCFGMMKDSRDGNSYRTNLAFTPPESLRTRR 157 EGN SCFG+MK+SRDG SY TNLAFTPPE LRT R Sbjct: 192 EGNPRLSCFGLMKNSRDGKSYSTNLAFTPPEYLRTGR 228 Score = 27.7 bits (60), Expect(2) = 2e-09 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +1 Query: 1 HDLTAYRIVFDD 36 HDL AYRIVFDD Sbjct: 180 HDLNAYRIVFDD 191 >ref|XP_008238844.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 isoform X2 [Prunus mume] Length = 406 Score = 60.5 bits (145), Expect(2) = 2e-09 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = +2 Query: 47 EGNS*FSCFGMMKDSRDGNSYRTNLAFTPPESLRTRR 157 +GN SCFGMMK+SRDG SY TNLAFTPPE LRT R Sbjct: 109 DGNPRLSCFGMMKNSRDGKSYSTNLAFTPPEYLRTGR 145 Score = 27.7 bits (60), Expect(2) = 2e-09 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +1 Query: 1 HDLTAYRIVFDD 36 HDL AYRIVFDD Sbjct: 97 HDLNAYRIVFDD 108 >ref|XP_008238845.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 isoform X3 [Prunus mume] Length = 355 Score = 60.5 bits (145), Expect(2) = 2e-09 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = +2 Query: 47 EGNS*FSCFGMMKDSRDGNSYRTNLAFTPPESLRTRR 157 +GN SCFGMMK+SRDG SY TNLAFTPPE LRT R Sbjct: 58 DGNPRLSCFGMMKNSRDGKSYSTNLAFTPPEYLRTGR 94 Score = 27.7 bits (60), Expect(2) = 2e-09 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +1 Query: 1 HDLTAYRIVFDD 36 HDL AYRIVFDD Sbjct: 46 HDLNAYRIVFDD 57 >ref|XP_002509803.1| receptor protein kinase, putative [Ricinus communis] gi|223549702|gb|EEF51190.1| receptor protein kinase, putative [Ricinus communis] Length = 273 Score = 60.5 bits (145), Expect(2) = 4e-09 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = +2 Query: 47 EGNS*FSCFGMMKDSRDGNSYRTNLAFTPPESLRTRR 157 EGN SCFG+MK+SRDG SY TNLAFTPPE LRT R Sbjct: 192 EGNPRLSCFGLMKNSRDGKSYSTNLAFTPPEYLRTGR 228 Score = 26.9 bits (58), Expect(2) = 4e-09 Identities = 9/12 (75%), Positives = 11/12 (91%) Frame = +1 Query: 1 HDLTAYRIVFDD 36 HDL AYR++FDD Sbjct: 180 HDLNAYRVIFDD 191 >ref|XP_007040223.1| Kinase protein with tetratricopeptide repeat domain isoform 4 [Theobroma cacao] gi|508777468|gb|EOY24724.1| Kinase protein with tetratricopeptide repeat domain isoform 4 [Theobroma cacao] Length = 491 Score = 59.3 bits (142), Expect(2) = 5e-09 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = +2 Query: 47 EGNS*FSCFGMMKDSRDGNSYRTNLAFTPPESLRT 151 EGN SCFG+MK+SRDG SY TNLAFTPPE LRT Sbjct: 192 EGNPRLSCFGLMKNSRDGKSYSTNLAFTPPEYLRT 226 Score = 27.7 bits (60), Expect(2) = 5e-09 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +1 Query: 1 HDLTAYRIVFDD 36 HDL AYRIVFDD Sbjct: 180 HDLNAYRIVFDD 191 >emb|CDP09742.1| unnamed protein product [Coffea canephora] Length = 489 Score = 59.3 bits (142), Expect(2) = 5e-09 Identities = 27/37 (72%), Positives = 30/37 (81%) Frame = +2 Query: 47 EGNS*FSCFGMMKDSRDGNSYRTNLAFTPPESLRTRR 157 +GN SCFG+MK+SRDG SY TNLAFTPPE LRT R Sbjct: 191 DGNPRLSCFGLMKNSRDGKSYSTNLAFTPPEYLRTGR 227 Score = 27.7 bits (60), Expect(2) = 5e-09 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +1 Query: 1 HDLTAYRIVFDD 36 HDL AYRIVFDD Sbjct: 179 HDLNAYRIVFDD 190 >ref|XP_012836282.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 [Erythranthe guttatus] Length = 487 Score = 60.5 bits (145), Expect(2) = 5e-09 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = +2 Query: 47 EGNS*FSCFGMMKDSRDGNSYRTNLAFTPPESLRTRR 157 EGN SCFG+MK+SRDG SY TNLAFTPPE LRT R Sbjct: 192 EGNPKLSCFGLMKNSRDGKSYSTNLAFTPPEYLRTGR 228 Score = 26.6 bits (57), Expect(2) = 5e-09 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = +1 Query: 1 HDLTAYRIVFDD 36 HDL AYRI+FDD Sbjct: 180 HDLNAYRILFDD 191 >ref|XP_008437265.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 [Cucumis melo] gi|659073811|ref|XP_008437266.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 [Cucumis melo] gi|659073813|ref|XP_008437267.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 [Cucumis melo] gi|659073815|ref|XP_008437268.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 [Cucumis melo] Length = 486 Score = 59.3 bits (142), Expect(2) = 5e-09 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = +2 Query: 47 EGNS*FSCFGMMKDSRDGNSYRTNLAFTPPESLRT 151 EGN SCFG+MK+SRDG SY TNLAFTPPE LRT Sbjct: 190 EGNPRLSCFGLMKNSRDGRSYSTNLAFTPPEYLRT 224 Score = 27.7 bits (60), Expect(2) = 5e-09 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +1 Query: 1 HDLTAYRIVFDD 36 HDL AYRIVFDD Sbjct: 178 HDLNAYRIVFDD 189 >ref|XP_004143908.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 [Cucumis sativus] gi|778699631|ref|XP_011654748.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 [Cucumis sativus] gi|778699634|ref|XP_011654749.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 [Cucumis sativus] gi|700194925|gb|KGN50102.1| hypothetical protein Csa_5G153170 [Cucumis sativus] Length = 486 Score = 59.3 bits (142), Expect(2) = 5e-09 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = +2 Query: 47 EGNS*FSCFGMMKDSRDGNSYRTNLAFTPPESLRT 151 EGN SCFG+MK+SRDG SY TNLAFTPPE LRT Sbjct: 190 EGNPRLSCFGLMKNSRDGRSYSTNLAFTPPEYLRT 224 Score = 27.7 bits (60), Expect(2) = 5e-09 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +1 Query: 1 HDLTAYRIVFDD 36 HDL AYRIVFDD Sbjct: 178 HDLNAYRIVFDD 189 >gb|EYU38349.1| hypothetical protein MIMGU_mgv1a009089mg [Erythranthe guttata] Length = 353 Score = 60.5 bits (145), Expect(2) = 5e-09 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = +2 Query: 47 EGNS*FSCFGMMKDSRDGNSYRTNLAFTPPESLRTRR 157 EGN SCFG+MK+SRDG SY TNLAFTPPE LRT R Sbjct: 58 EGNPKLSCFGLMKNSRDGKSYSTNLAFTPPEYLRTGR 94 Score = 26.6 bits (57), Expect(2) = 5e-09 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = +1 Query: 1 HDLTAYRIVFDD 36 HDL AYRI+FDD Sbjct: 46 HDLNAYRILFDD 57 >gb|KOM26238.1| hypothetical protein LR48_Vigan238s007100 [Vigna angularis] Length = 509 Score = 62.4 bits (150), Expect(2) = 7e-09 Identities = 29/38 (76%), Positives = 31/38 (81%) Frame = +2 Query: 44 QEGNS*FSCFGMMKDSRDGNSYRTNLAFTPPESLRTRR 157 QEGN SCFG+MK+SRDG SY TNLAFTPPE LRT R Sbjct: 209 QEGNPRLSCFGLMKNSRDGRSYSTNLAFTPPEYLRTGR 246 Score = 24.3 bits (51), Expect(2) = 7e-09 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = +1 Query: 1 HDLTAYRIVFD 33 HDL AYRI+FD Sbjct: 198 HDLNAYRILFD 208 >ref|XP_014494516.1| PREDICTED: probable serine/threonine-protein kinase At5g41260 [Vigna radiata var. radiata] Length = 492 Score = 62.4 bits (150), Expect(2) = 7e-09 Identities = 29/38 (76%), Positives = 31/38 (81%) Frame = +2 Query: 44 QEGNS*FSCFGMMKDSRDGNSYRTNLAFTPPESLRTRR 157 QEGN SCFG+MK+SRDG SY TNLAFTPPE LRT R Sbjct: 192 QEGNPRLSCFGLMKNSRDGRSYSTNLAFTPPEYLRTGR 229 Score = 24.3 bits (51), Expect(2) = 7e-09 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = +1 Query: 1 HDLTAYRIVFD 33 HDL AYRI+FD Sbjct: 181 HDLNAYRILFD 191