BLASTX nr result
ID: Papaver30_contig00061050
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00061050 (792 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO46178.1| hypothetical protein CISIN_1g036608mg, partial [C... 61 1e-06 >gb|KDO46178.1| hypothetical protein CISIN_1g036608mg, partial [Citrus sinensis] Length = 565 Score = 60.8 bits (146), Expect = 1e-06 Identities = 27/72 (37%), Positives = 45/72 (62%) Frame = -3 Query: 406 EYWIRMPICGHILANAFHCVIHSISYADSVTYAPTRRVFTEEESLKIVIMGFVSMNHYIG 227 EYW+ MP GHI+A+ ++ V+ IS ++T+ P R + S KI+ +GFV+ NH+I Sbjct: 450 EYWMTMPEIGHIIASKYNVVLLHISDVLNLTFLPLRSIPLSRSSHKIIAIGFVNRNHFIE 509 Query: 226 LQLKDECPLPPL 191 + + P+PP+ Sbjct: 510 VFMLPASPIPPI 521