BLASTX nr result
ID: Papaver30_contig00059995
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00059995 (556 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013454715.1| F-box and associated interaction domain prot... 58 3e-06 ref|XP_013463726.1| F-box protein interaction domain protein [Me... 56 1e-05 >ref|XP_013454715.1| F-box and associated interaction domain protein [Medicago truncatula] gi|657386410|gb|KEH28746.1| F-box and associated interaction domain protein [Medicago truncatula] Length = 419 Score = 58.2 bits (139), Expect = 3e-06 Identities = 23/44 (52%), Positives = 34/44 (77%) Frame = +2 Query: 395 LPEEIMLEILSRVPTDSILQYKSVSKRWRNVFQHPSFSQMHLDH 526 LP+E++ EILSR+P S++Q KSV K W+ + HPSF ++HL+H Sbjct: 19 LPDEVLTEILSRLPVKSLIQMKSVCKSWKTLISHPSFIKIHLNH 62 >ref|XP_013463726.1| F-box protein interaction domain protein [Medicago truncatula] gi|657398139|gb|KEH37761.1| F-box protein interaction domain protein [Medicago truncatula] Length = 387 Score = 56.2 bits (134), Expect = 1e-05 Identities = 24/45 (53%), Positives = 33/45 (73%) Frame = +2 Query: 395 LPEEIMLEILSRVPTDSILQYKSVSKRWRNVFQHPSFSQMHLDHL 529 LP+E++ EILSR+P S+LQYK VSK W+ + P F+Q HL +L Sbjct: 28 LPDELVFEILSRLPVKSLLQYKCVSKSWKTLISDPQFTQTHLRNL 72