BLASTX nr result
ID: Papaver30_contig00059715
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00059715 (864 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007038597.1| Retrotransposon, unclassified-like protein [... 69 5e-09 ref|XP_007032383.1| H0502G05.11 protein [Theobroma cacao] gi|508... 68 8e-09 ref|XP_007044604.1| H0502G05.11 protein [Theobroma cacao] gi|508... 68 8e-09 >ref|XP_007038597.1| Retrotransposon, unclassified-like protein [Theobroma cacao] gi|508775842|gb|EOY23098.1| Retrotransposon, unclassified-like protein [Theobroma cacao] Length = 1609 Score = 68.9 bits (167), Expect = 5e-09 Identities = 32/87 (36%), Positives = 53/87 (60%) Frame = -2 Query: 290 EMSRRPLAQEQLDSRYLHFPFQMKKILEMLEAWVRNGEVELPPVWRPPTDQEIMDPRYCH 111 ++ RR L +E S P + ++ +L+ WVR+G++ LP RPPT +E +PRYC Sbjct: 362 DVPRRGLDEENDSSPPFSVP--LDRVRALLQEWVRDGQINLPYTPRPPTTEEKANPRYCD 419 Query: 110 YHRFLHHPTSEFNALKRIVQKKLNSGE 30 YHR + HP +E L+R+ +++ +GE Sbjct: 420 YHRTVGHPLAECRNLRRMFHRRVQAGE 446 >ref|XP_007032383.1| H0502G05.11 protein [Theobroma cacao] gi|508711412|gb|EOY03309.1| H0502G05.11 protein [Theobroma cacao] Length = 1352 Score = 68.2 bits (165), Expect = 8e-09 Identities = 32/87 (36%), Positives = 53/87 (60%) Frame = -2 Query: 290 EMSRRPLAQEQLDSRYLHFPFQMKKILEMLEAWVRNGEVELPPVWRPPTDQEIMDPRYCH 111 ++ RR L +E S P + ++ +L+ WVR+G++ LP RPPT +E +PRYC Sbjct: 327 DVPRRGLDEENDSSPPFSVP--LDRVRALLQEWVRDGQINLPYTPRPPTAKEKANPRYCD 384 Query: 110 YHRFLHHPTSEFNALKRIVQKKLNSGE 30 YHR + HP +E L+R+ +++ +GE Sbjct: 385 YHRTVGHPLAECRNLRRMFHRRVQAGE 411 >ref|XP_007044604.1| H0502G05.11 protein [Theobroma cacao] gi|508708539|gb|EOY00436.1| H0502G05.11 protein [Theobroma cacao] Length = 537 Score = 68.2 bits (165), Expect = 8e-09 Identities = 32/87 (36%), Positives = 53/87 (60%) Frame = -2 Query: 290 EMSRRPLAQEQLDSRYLHFPFQMKKILEMLEAWVRNGEVELPPVWRPPTDQEIMDPRYCH 111 ++ RR L +E S P + ++ +L+ WVR+G++ LP RPPT +E +PRYC Sbjct: 362 DVPRRGLDEENDSSPPFSVP--LDRVRALLQEWVRDGQINLPYTPRPPTTEEKANPRYCD 419 Query: 110 YHRFLHHPTSEFNALKRIVQKKLNSGE 30 YHR + HP +E L+R+ +++ +GE Sbjct: 420 YHRTVGHPLAECRNLRRMFHQQVQAGE 446