BLASTX nr result
ID: Papaver30_contig00058658
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00058658 (585 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007025312.1| Uncharacterized protein TCM_029644 [Theobrom... 57 7e-06 >ref|XP_007025312.1| Uncharacterized protein TCM_029644 [Theobroma cacao] gi|508780678|gb|EOY27934.1| Uncharacterized protein TCM_029644 [Theobroma cacao] Length = 115 Score = 57.0 bits (136), Expect = 7e-06 Identities = 28/55 (50%), Positives = 35/55 (63%) Frame = -3 Query: 346 FQILAKGRFPASGPSHKGNSIPISARHLLRTSALAQTPSLRSTTYTSEPSPGVGH 182 F++L KGR SGPSH+GN+ PI RHLLR + + L TS PSPG+GH Sbjct: 65 FRVLMKGRITPSGPSHRGNAEPIFTRHLLRNNDIISFQEL-----TSVPSPGIGH 114