BLASTX nr result
ID: Papaver30_contig00058581
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00058581 (427 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004287229.1| PREDICTED: uncharacterized protein LOC101294... 57 7e-06 >ref|XP_004287229.1| PREDICTED: uncharacterized protein LOC101294691 [Fragaria vesca subsp. vesca] Length = 494 Score = 56.6 bits (135), Expect = 7e-06 Identities = 31/95 (32%), Positives = 48/95 (50%), Gaps = 4/95 (4%) Frame = -2 Query: 426 LIEQLKDNFILNTTSPSVRRFLNYRMSKGYTNFKCEMLMHFRNYVSIEEARGNP----FG 259 L ++++ NF ++ PS+ +LN M K Y FKCE+ H++ S+EEA P Sbjct: 218 LRKEVEVNFDVDVQRPSIIHYLNKLMGKVYREFKCELHKHYKKMRSLEEALDKPPKAMIA 277 Query: 258 NISPANWSSLCDLFVLERIKKCRDRHENFKA*RAY 154 PA W LC F E+ KK + + +A + Y Sbjct: 278 RNDPAQWKCLCKHFSEEKFKKKSETNAKNRAGKEY 312