BLASTX nr result
ID: Papaver30_contig00058539
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00058539 (520 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAU84988.1| anthranilate synthase alpha 1 [Camptotheca acumin... 59 2e-06 >gb|AAU84988.1| anthranilate synthase alpha 1 [Camptotheca acuminata] Length = 581 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 520 SDPDDEQRECENKAAGTSRAIDLAESAFVE 431 SDPDDEQRECENKAAG +RAIDLAESAFV+ Sbjct: 551 SDPDDEQRECENKAAGLARAIDLAESAFVD 580