BLASTX nr result
ID: Papaver30_contig00058122
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00058122 (619 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008348795.1| PREDICTED: uncharacterized protein LOC103411... 50 7e-06 >ref|XP_008348795.1| PREDICTED: uncharacterized protein LOC103411964 [Malus domestica] Length = 892 Score = 50.4 bits (119), Expect(2) = 7e-06 Identities = 23/57 (40%), Positives = 32/57 (56%), Gaps = 1/57 (1%) Frame = -2 Query: 168 WRNLMHPVIQRYKLMKFLDGSFPCPPPY-SSPRNEANGIENPNYTD*IEEDSTIRMW 1 WR L P+ +RYKL + +DGS CPPP+ + I NPN+ E+D I +W Sbjct: 264 WRALFAPIFRRYKLTEIIDGSEXCPPPFLPDXSGVTSEIPNPNFEIWYEKDQNILIW 320 Score = 26.6 bits (57), Expect(2) = 7e-06 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = -3 Query: 254 SHTITFSKVSLNQINNFVTLKLKEDNYL 171 S++ S +S+ I+ V KLK+DNYL Sbjct: 235 SNSSLVSSISIQNISCMVPTKLKKDNYL 262